Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitogen-activated protein kinase 7 (MAPK7) Recombinant Protein | MAPK7 recombinant protein

Recombinant Bovine Mitogen-activated protein kinase 7 (MAPK7) , partial

Gene Names
MAPK7; ERK-5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitogen-activated protein kinase 7 (MAPK7); Recombinant Bovine Mitogen-activated protein kinase 7 (MAPK7); partial; MAPK7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
55-347. partial
Sequence
YEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARVSAAAALRHPFL
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MAPK7 recombinant protein
This protein is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5
MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,832 Da
NCBI Official Full Name
mitogen-activated protein kinase 7
NCBI Official Synonym Full Names
mitogen-activated protein kinase 7
NCBI Official Symbol
MAPK7
NCBI Official Synonym Symbols
ERK-5
NCBI Protein Information
mitogen-activated protein kinase 7
UniProt Protein Name
Mitogen-activated protein kinase 7
UniProt Gene Name
MAPK7
UniProt Synonym Gene Names
MAP kinase 7; MAPK 7

Uniprot Description

Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways. Phosphorylates SGK1 at Ser-78 and this is required for growth factor-induced cell cycle progression (). Involved in the regulation of p53/TP53 by disrupting the PML-MDM2 interaction ().

Similar Products

Product Notes

The MAPK7 mapk7 (Catalog #AAA1146712) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 55-347. partial. The amino acid sequence is listed below: YEIIETIGNG AYGVVSSARR RLTGQQVAIK KIPNAFDVVT NAKRTLRELK ILKHFKHDNI IAIKDILRPT VPYGEFKSVY VVLDLMESDL HQIIHSSQPL TLEHVRYFLY QLLRGLKYMH SAQVIHRDLK PSNLLVNENC ELKIGDFGMA RGLCTSPAEH QYFMTEYVAT RWYRAPELML SLHEYTQAID LWSVGCIFGE MLARRQLFPG KNYVHQLQLI MTVLGTPSPA VIQAVGAERV RAYIQSLPPR QPVPWETVYP GADRQALSLL GRMLRFEPSA RVSAAAALRH PFL . It is sometimes possible for the material contained within the vial of "Mitogen-activated protein kinase 7 (MAPK7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.