Uncharacterized N-acetyltransferase YhhY (yhhY) Recombinant Protein | yhhY recombinant protein

Recombinant Escherichia coli Uncharacterized N-acetyltransferase YhhY (yhhY)

Cat. Num. AAA1142090

• Gene Names: yhhY; ECK3427; JW3405
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Uncharacterized N-acetyltransferase YhhY (yhhY); Recombinant Escherichia coli Uncharacterized N-acetyltransferase YhhY (yhhY); yhhY recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-162, full length protein
• Sequence: MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK
• Sequence Length: 162

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16131313
• NCBI GeneID: 947943
• NCBI Accession #: NP_417898.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P46854; Q2M7A4
• Molecular Weight: 18,794 Da
• NCBI Official Full Name: aminoacyl nucleotide detoxifying acetyltransferase
• NCBI Official Symbol: yhhY
• NCBI Official Synonym Symbols: ECK3427; JW3405
• NCBI Protein Information: aminoacyl nucleotide detoxifying acetyltransferase
• UniProt Protein Name: L-amino acid N-acetyltransferase AaaT
• UniProt Gene Name: aaaT

NCBI Description

Regulation has been described . [More information is available at EcoCyc: G7758].

Uniprot Description

Catalyzes the N-acetylation of L-phenylalanine and L-methionine using acetyl-CoA as acetyl donor in vitro. Cannot accept L-tyrosine as substrate and propionyl-CoA, succinyl-CoA or (S)-methylmalonyl-CoA as acyl donors (PubMed:27941785). Is also able to acetylate and thus detoxify several nonhydrolyzable aminoacyl adenylates, but not the processed form of the peptide-nucleotide antibiotic microcin C (McC). When overproduced, provides complete resistance to leucyl sulfamoyl adenylate (LSA) and partial resistance to alanyl sulfamoyl adenylate (ASA) and phenylalanyl sulfamoyl adenylate (FSA). Therefore, may protect bacteria from various toxic aminoacyl nucleotides, either exogenous or those generated inside the cell during normal metabolism (PubMed:25002546).