Cytochrome c biogenesis protein CcsB (ccsB) Recombinant Protein | Npun_R5677 recombinant protein
Recombinant Nostoc punctiforme Cytochrome c biogenesis protein CcsB (ccsB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c biogenesis protein CcsB (ccsB); Recombinant Nostoc punctiforme Cytochrome c biogenesis protein CcsB (ccsB); Recombinant Cytochrome c biogenesis protein CcsB (ccsB); Cytochrome c biogenesis protein CcsB; Npun_R5677 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-465
Sequence
MTLEDSASKELKWWAIPGQFLRQELLPVLTNLRLAIALLLLIAIFSSTGTVIEQGQSPAFYQANYPEHPALFGFLTWKVIQVVGLDHVYRTWWFLALLILFGTSLTACSFTRQLPALKAAQRWKYYEEPRQFQKLALSAELDNGSLNSLSQLLQKRRYKIFPDREKENILYARKGIVGRIGPIIVHIGIVAILLGGIWGAMTGFMAQEMVASGDTFQVTNIVDAGPLAAQVSKDWSVRVNRFWIDYTPSGGIDQFYSDMSVLNKQGEEVDHKKIFVNEPLRYRGITFYQTDWGIAGVRVQFNNSPIFQLPMALLNTKGQGRIWGTWVPTKPDLSEGVSLLAKDLQGMVLIYDPNGKLVDTVRAGMSTQVNGVKLKILDVIGSTGLQIKADPGIPIVYSGFGLLMLGVVMSYFSHSQIWALQKGDLLYVGGKTNRAQVAFEQEVLEILDRLSSEPKIEEKETAIEV
Sequence Length
465
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,006 Da
NCBI Official Full Name
ResB family protein
NCBI Official Symbol
Npun_R5677
NCBI Protein Information
ResB family protein
UniProt Protein Name
Cytochrome c biogenesis protein CcsB
UniProt Gene Name
ccsB
UniProt Synonym Gene Names
ccs1
UniProt Entry Name
CCS1_NOSP7
Uniprot Description
Function: Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment
By similarity. HAMAP-Rule MF_01392
Subunit structure: May interact with CcsA
By similarity. HAMAP-Rule MF_01392
Subcellular location: Cellular thylakoid membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01392.
Sequence similarities: Belongs to the ccs1/ccsB family.
Similar Products
Product Notes
The Npun_R5677 ccsb (Catalog #AAA1141200) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-465. The amino acid sequence is listed below: MTLEDSASKE LKWWAIPGQF LRQELLPVLT NLRLAIALLL LIAIFSSTGT VIEQGQSPAF YQANYPEHPA LFGFLTWKVI QVVGLDHVYR TWWFLALLIL FGTSLTACSF TRQLPALKAA QRWKYYEEPR QFQKLALSAE LDNGSLNSLS QLLQKRRYKI FPDREKENIL YARKGIVGRI GPIIVHIGIV AILLGGIWGA MTGFMAQEMV ASGDTFQVTN IVDAGPLAAQ VSKDWSVRVN RFWIDYTPSG GIDQFYSDMS VLNKQGEEVD HKKIFVNEPL RYRGITFYQT DWGIAGVRVQ FNNSPIFQLP MALLNTKGQG RIWGTWVPTK PDLSEGVSLL AKDLQGMVLI YDPNGKLVDT VRAGMSTQVN GVKLKILDVI GSTGLQIKAD PGIPIVYSGF GLLMLGVVMS YFSHSQIWAL QKGDLLYVGG KTNRAQVAFE QEVLEILDRL SSEPKIEEKE TAIEV. It is sometimes possible for the material contained within the vial of "Cytochrome c biogenesis protein CcsB (ccsB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
