Mitochondrial translocator assembly and maintenance protein 41 (TAM41) Recombinant Protein | TAM41 recombinant protein
Recombinant Saccharomyces cerevisiae Mitochondrial translocator assembly and maintenance protein 41 (TAM41)
Gene Names
TAM41; MMP37
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial translocator assembly and maintenance protein 41 (TAM41); Recombinant Saccharomyces cerevisiae Mitochondrial translocator assembly and maintenance protein 41 (TAM41); TAM41 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-385, full length protein
Sequence
RSSIDDAGIIPDGTINERPNHYIEGITKGSDLDLLEKGIRKTDEMTSNFTNYMYKFHRLPPNYGSNQLITIDKELQKELDGVMSSFKAPCRFVFGYGSGVFEQAGYSKSHSKPQIDIILGVTYPSHFHSINMRQNPQHYSSLKYFGSEFVSKFQQIGAGVYFNPFANINGHDVKYGVVSMETLLKDIATWNTFYLAGRLQKPVKILKNDLRVQYWNQLNLKAAATLAKHYTLEKNNNKFDEFQFYKEITALSYAGDIRYKLGGENPDKVNNIVTKNFERFQEYYKPIYKEVVLNDSFYLPKGFTLKNTQRLLLSRISKSSALQTIKGVFTAGITKSIKYAWAKKLKSMRRS
Sequence Length
351
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,200 Da
NCBI Official Full Name
putative phosphatidate cytidylyltransferase
NCBI Official Symbol
TAM41
NCBI Official Synonym Symbols
MMP37
NCBI Protein Information
putative phosphatidate cytidylyltransferase
UniProt Protein Name
Phosphatidate cytidylyltransferase, mitochondrial
UniProt Gene Name
TAM41
UniProt Synonym Gene Names
MMP37; CDP-DAG synthase
Uniprot Description
Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.
Research Articles on TAM41
Similar Products
Product Notes
The TAM41 tam41 (Catalog #AAA1138568) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-385, full length protein. The amino acid sequence is listed below: RSSIDDAGII PDGTINERPN HYIEGITKGS DLDLLEKGIR KTDEMTSNFT NYMYKFHRLP PNYGSNQLIT IDKELQKELD GVMSSFKAPC RFVFGYGSGV FEQAGYSKSH SKPQIDIILG VTYPSHFHSI NMRQNPQHYS SLKYFGSEFV SKFQQIGAGV YFNPFANING HDVKYGVVSM ETLLKDIATW NTFYLAGRLQ KPVKILKNDL RVQYWNQLNL KAAATLAKHY TLEKNNNKFD EFQFYKEITA LSYAGDIRYK LGGENPDKVN NIVTKNFERF QEYYKPIYKE VVLNDSFYLP KGFTLKNTQR LLLSRISKSS ALQTIKGVFT AGITKSIKYA WAKKLKSMRR S. It is sometimes possible for the material contained within the vial of "Mitochondrial translocator assembly and maintenance protein 41 (TAM41), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
