Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cathepsin E (Ctse) Recombinant Protein | Ctse recombinant protein

Recombinant Rat Cathepsin E (Ctse)

Gene Names
Ctse; CEA; CEB; Ctsea
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin E (Ctse); Recombinant Rat Cathepsin E (Ctse); Ctse recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
59-398, full length protein
Sequence
SESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP
Sequence Length
340
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctse recombinant protein
This protein is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,445 Da
NCBI Official Full Name
cathepsin E
NCBI Official Synonym Full Names
cathepsin E
NCBI Official Symbol
Ctse
NCBI Official Synonym Symbols
CEA; CEB; Ctsea
NCBI Protein Information
cathepsin E
UniProt Protein Name
Cathepsin E
Protein Family
UniProt Gene Name
Ctse

NCBI Description

intracellular, nonlysosomal aspartic proteinase; may mediate absorption, secretion, and digestion of various cellular components [RGD, Feb 2006]

Uniprot Description

May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain ().

Research Articles on Ctse

Similar Products

Product Notes

The Ctse ctse (Catalog #AAA1137545) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 59-398, full length protein. The amino acid sequence is listed below: SESCNVDKGI NEPLINYLDM EYFGTVSIGS PSQNFTVIFD TGSSNLWVPS VYCTSPACKA HPVFHPSQSS TYMEVGNHFS IQYGTGSLTG IIGADQVSVE GLTVEGQQFG ESVKEPGQTF VNAEFDGILG LGYPSLAVGG VTPVFDNMMA QNLVALPMFS VYLSSDPQGG SGSELTFGGY DPSHFSGSLN WIPVTKQGYW QIALDGIQVG DTVMFCSEGC QAIVDTGTSL ITGPPKKIKQ LQEAIGATPM DGEYAVDCAT LNMMPNVTFL INGVSYTLSP TAYILPDLVD GMQFCGSGFQ GLDIQPPAGP LWILGDVFIR KFYSVFDRGN NQVGLAPAVP. It is sometimes possible for the material contained within the vial of "Cathepsin E (Ctse), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.