Fimbrillin matB homolog (matB) Recombinant Protein | matB recombinant protein
Recombinant Escherichia coli Fimbrillin matB homolog (matB)
Gene Names
ecpA; ECK0292; JW0287; matB; yagZ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fimbrillin matB homolog (matB); Recombinant Escherichia coli Fimbrillin matB homolog (matB); matB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-195, full length protein
Sequence
ADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS
Sequence Length
173
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,111 Da
NCBI Official Full Name
ECP pilin
NCBI Official Symbol
ecpA
NCBI Official Synonym Symbols
ECK0292; JW0287; matB; yagZ
NCBI Protein Information
ECP pilin
UniProt Protein Name
Common pilus major fimbrillin subunit EcpA
UniProt Gene Name
ecpA
UniProt Synonym Gene Names
matB; yagZ
NCBI Description
SecB-dependent cleavage (Marani, 2006). [More information is available at EcoGene: EG13565]. MatB is a fimbrillin that is expressed in pathogenic Escherichia coli strains at low temperatures. [More information is available at EcoCyc: G6164].
Uniprot Description
Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition. Major subunit of the fimbria ().
Research Articles on matB
Similar Products
Product Notes
The matB ecpa (Catalog #AAA1137353) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-195, full length protein. The amino acid sequence is listed below: ADVTAQAVAT WSATAKKDTT SKLVVTPLGS LAFQYAEGIK GFNSQKGLFD VAIEGDSTAT AFKLTSRLIT NTLTQLDTSG STLNVGVDYN GAAVEKTGDT VMIDTANGVL GGNLSPLANG YNASNRTTAQ DGFTFSIISG TTNGTTAVTD YSTLPEGIWS GDVSVQFDAT WTS. It is sometimes possible for the material contained within the vial of "Fimbrillin matB homolog (matB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
