Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein P1 (ORF1) Recombinant Protein | TYVgp3 recombinant protein

Recombinant Turnip yellows virus Protein P1 (ORF1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein P1 (ORF1); Recombinant Turnip yellows virus Protein P1 (ORF1); Recombinant Protein P1 (ORF1); Protein P1; 66.2 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25; TYVgp3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
401-607
Sequence
TTAPQGRVFAQEDIAEIEGLYAQVMKRVQQAEDFKPKTGKYWGDMEDDEDIFFESKEDLSGNGVRGTVRGTNGEGSSTPKTSNVDGKEMMEKIISSLVGKINLENIERKVIEEISAKAMKTPKSRRRRAPKKQPESSKDTSPRSTTGKYQPPHVRSPASVTAANCPNTTTPSKKKNLAGGRPSSGTIPRWVRKQAASAGPSSAPKQN
Sequence Length
607
Species
Turnip yellows virus (isolate FL-1) (TuYV) (BWYV-FL1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,211 Da
NCBI Official Full Name
hypothetical protein
NCBI Official Symbol
TYVgp3
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Protein P1
UniProt Entry Name
P1_TYYVF

Uniprot Description

Function: Precursor from which the VPg molecule is probably released at the onset of the RNA synthesis. Essential for virus replication

By similarity.

Subcellular location: Protein P1: Membrane; Multi-pass membrane protein

Potential.

Domain: The C-terminus part of protein P1 and VPg/P1-C25 displays RNA-binding properties

By similarity.

Post-translational modification: Specific enzymatic cleavages in vivo yield mature proteins. The protease probably cleaves itself and releases the VPg protein

By similarity.

Sequence similarities: Belongs to the peptidase S39B family.

Similar Products

Product Notes

The TYVgp3 (Catalog #AAA1130950) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 401-607. The amino acid sequence is listed below: TTAPQGRVFA QEDIAEIEGL YAQVMKRVQQ AEDFKPKTGK YWGDMEDDED IFFESKEDLS GNGVRGTVRG TNGEGSSTPK TSNVDGKEMM EKIISSLVGK INLENIERKV IEEISAKAMK TPKSRRRRAP KKQPESSKDT SPRSTTGKYQ PPHVRSPASV TAANCPNTTT PSKKKNLAGG RPSSGTIPRW VRKQAASAGP SSAPKQN. It is sometimes possible for the material contained within the vial of "Protein P1 (ORF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.