Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial import inner membrane translocase subunit TIM21 (TIM21) Recombinant Protein | TIM21 recombinant protein

Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit TIM21 (TIM21); Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21); Recombinant Mitochondrial import inner membrane translocase subunit TIM21 (TIM21); Mitochondrial import inner membrane translocase subunit TIM21; TIM21 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
71-239
Sequence
ASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD
Sequence Length
239
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,206 Da
NCBI Official Full Name
Tim21p
NCBI Official Symbol
TIM21
NCBI Protein Information
Tim21p
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM21
UniProt Gene Name
TIM21
UniProt Entry Name
TIM21_YEAST

Uniprot Description

Function: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix. In the complex, it acts as an antagonist of TIM50 by reducing preprotein accumulation at the TOM23 complex and promotes dissociation of the PAM complex from the TIM23 complex. Ref.7 Ref.8

Subunit structure: Component of the TIM23 complex, at least composed of TIM23, TIM17, TIM50 and TIM21. Interacts directly with TIM23. Interacts with TOM22 component of the TOM complex. Released from the TOM23 complex by the PAM complex, leading to protein translocation into the mitochondrial matrix. Ref.7 Ref.8

Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein Ref.5 Ref.7.

Miscellaneous: Present with 3770 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the TIM21 family.

Research Articles on TIM21

Similar Products

Product Notes

The TIM21 tim21 (Catalog #AAA1128935) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 71-239. The amino acid sequence is listed below: ASTFTFSGIL VIGAVGISAI VIYLILSELF SPSGDTQLFN RAVSMVEKNK DIRSLLQCDD GITGKERLKA YGELITNDKW TRNRPIVSTK KLDKEGRTHH YMRFHVESKK KIALVHLEAK ESKQNYQPDF INMYVDVPGE KRYYLIKPKL HPVSNSKGFL GIRWGPRKD. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit TIM21 (TIM21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.