Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Very long-chain acyl-CoA synthetase (Slc27a2) Recombinant Protein | Slc27a2 recombinant protein

Recombinant Mouse Very long-chain acyl-CoA synthetase (Slc27a2)

Gene Names
Slc27a2; VLCS; Vlac; FATP2; Vlacs; ACSVL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Very long-chain acyl-CoA synthetase (Slc27a2); Recombinant Mouse Very long-chain acyl-CoA synthetase (Slc27a2); Slc27a2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-620
Sequence
MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRYFLRLANMARRVRSYRQRRPVRTILRAFLEQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWIWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVFYVSRTSNTNGVDTILDKVDGVSAEPTPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYEFYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKGEVGLLVCKITQLTPFIGYAGGKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGKKLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEKTFVPMTENIYNAIIDKTLKL
Sequence Length
620
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Slc27a2 recombinant protein
Slc27a2; Acsvl1, Facvl1, Fatp2, Vlacs, Vlcs

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,423 Da
NCBI Official Full Name
very long-chain acyl-CoA synthetase
NCBI Official Synonym Full Names
solute carrier family 27 (fatty acid transporter), member 2
NCBI Official Symbol
Slc27a2
NCBI Official Synonym Symbols
VLCS; Vlac; FATP2; Vlacs; ACSVL1
NCBI Protein Information
very long-chain acyl-CoA synthetase; FATP-2; THCA-CoA ligase; fatty acid transport protein 2; long-chain-fatty-acid--CoA ligase; solute carrier family 27 member 2; very long-chain-fatty-acid-CoA ligase; fatty-acid-coenzyme A ligase, very long-chain 1; very long-chain acyl-Coenzyme A dehydrogenase synthase
UniProt Protein Name
Very long-chain acyl-CoA synthetase
UniProt Gene Name
Slc27a2
UniProt Synonym Gene Names
Acsvl1; Facvl1; Fatp2; Vlacs; Vlcs; VLACS; VLCS; FATP-2
UniProt Entry Name
S27A2_MOUSE

Uniprot Description

SLC27A2: Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes. Belongs to the ATP-dependent AMP-binding enzyme family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 6.2.1.3; Membrane protein, multi-pass; Ligase

Cellular Component: peroxisomal membrane; integral to peroxisomal membrane; endoplasmic reticulum membrane; intracellular membrane-bound organelle; mitochondrion; membrane; endoplasmic reticulum lumen; endoplasmic reticulum; integral to membrane; integral to endoplasmic reticulum membrane; peroxisome

Molecular Function: branched-chain acyl-CoA synthetase (ADP-forming) activity; acyl-CoA ligase activity; fatty acid transporter activity; succinate-CoA ligase activity; nucleotide binding; 2-oxo-delta3-4,5,5-trimethylcyclopentenylacetyl-CoA synthetase activity; 3-isopropenyl-6-oxoheptanoyl-CoA synthetase activity; very-long-chain-fatty-acid-CoA ligase activity; 3-oxo-2-(2'-pentenyl)cyclopentane-1-octanoic acid (OPC-8:0) CoA ligase activity; phytanate-CoA ligase activity; enzyme binding; fatty-acid ligase activity; benzoyl acetate-CoA ligase activity; 2,4-dichlorobenzoate-CoA ligase activity; aryl-CoA synthetase (ADP-forming) activity; catalytic activity; ATP binding; receptor binding; long-chain-fatty-acid-CoA ligase activity; ligase activity

Biological Process: bile acid biosynthetic process; fatty acid beta-oxidation; very-long-chain fatty acid catabolic process; very-long-chain fatty acid metabolic process; metabolic process; lipid metabolic process; long-chain fatty acid metabolic process; fatty acid metabolic process; fatty acid transport; fatty acid alpha-oxidation

Research Articles on Slc27a2

Similar Products

Product Notes

The Slc27a2 slc27a2 (Catalog #AAA1128817) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-620. The amino acid sequence is listed below: MLPVLYTGLA GLLLLPLLLT CCCPYLLQDV RYFLRLANMA RRVRSYRQRR PVRTILRAFL EQARKTPHKP FLLFRDETLT YAQVDRRSNQ VARALHDQLG LRQGDCVALF MGNEPAYVWI WLGLLKLGCP MACLNYNIRA KSLLHCFQCC GAKVLLASPD LQEAVEEVLP TLKKDAVSVF YVSRTSNTNG VDTILDKVDG VSAEPTPESW RSEVTFTTPA VYIYTSGTTG LPKAATINHH RLWYGTGLAM SSGITAQDVI YTTMPLYHSA ALMIGLHGCI VVGATLALRS KFSASQFWDD CRKYNVTVIQ YIGELLRYLC NTPQKPNDRD HKVKKALGNG LRGDVWREFI KRFGDIHVYE FYASTEGNIG FVNYPRKIGA VGRANYLQRK VARYELIKYD VEKDEPVRDA NGYCIKVPKG EVGLLVCKIT QLTPFIGYAG GKTQTEKKKL RDVFKKGDIY FNSGDLLMID RENFVYFHDR VGDTFRWKGE NVATTEVADI VGLVDFVEEV NVYGVPVPGH EGRIGMASLK IKENYEFNGK KLFQHIAEYL PSYARPRFLR IQDTIEITGT FKHRKVTLME EGFNPTVIKD TLYFMDDAEK TFVPMTENIY NAIIDKTLKL. It is sometimes possible for the material contained within the vial of "Very long-chain acyl-CoA synthetase (Slc27a2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.