3-ketoacyl-CoA reductase (PICST_79198) Recombinant Protein | YBO9 recombinant protein
Recombinant Scheffersomyces stipitis 3-ketoacyl-CoA reductase (PICST_79198)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA reductase (PICST_79198); Recombinant Scheffersomyces stipitis 3-ketoacyl-CoA reductase (PICST_79198); Recombinant 3-ketoacyl-CoA reductase (PICST_79198); 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR EC= 1.1.1.-; Microsomal beta-keto-reductase; YBO9 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-346
Sequence
MSVVDFIQAITENKFGEYVLLGALLVGVFKLTVFILSVTSLLVDLFVLPATNLKTYGAKKGKWAVITGASDGIGKEYAFQLASKGFNVVLVSRTQAKLETLASEIEAKYKVETKVVAFDASTDAEDNYKSLGDAISGLPVTVLINNVGQSHSIPVPFLETENKELQDIITINVTATLKITQTVAPVIAETVSKEKKKVRGLILTMGSFGGLLPTPYLATYSGSKSFLQAWSAALAGELQSQGVDVELVISYLVTSAMSKIRRASLSIPSPKNFVRATLNGIGRRNGAQERYATSTPYWAHALMHFGIDQTVGVYSKLANSLNLNMHKSIRARALKKAARLAAEKKD
Sequence Length
346
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,350 Da
NCBI Official Full Name
beta-hydroxysteroid dehydrogenase type 3
NCBI Official Symbol
YBO9
NCBI Protein Information
beta-hydroxysteroid dehydrogenase type 3
UniProt Protein Name
Very-long-chain 3-oxoacyl-CoA reductase
UniProt Gene Name
3-ketoreductase
UniProt Synonym Gene Names
KAR
UniProt Entry Name
MKAR_PICST
Uniprot Description
Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids
By similarity. HAMAP-Rule MF_03107
Catalytic activity: A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP+ = a very-long-chain 3-oxoacyl-CoA + NADPH. HAMAP-Rule MF_03107
Subcellular location: Endoplasmic reticulum membrane
By similarity; Single-pass membrane protein
Potential HAMAP-Rule MF_03107.
Sequence similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Similar Products
Product Notes
The YBO9 3-ketoreductase (Catalog #AAA1122084) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346. The amino acid sequence is listed below: MSVVDFIQAI TENKFGEYVL LGALLVGVFK LTVFILSVTS LLVDLFVLPA TNLKTYGAKK GKWAVITGAS DGIGKEYAFQ LASKGFNVVL VSRTQAKLET LASEIEAKYK VETKVVAFDA STDAEDNYKS LGDAISGLPV TVLINNVGQS HSIPVPFLET ENKELQDIIT INVTATLKIT QTVAPVIAET VSKEKKKVRG LILTMGSFGG LLPTPYLATY SGSKSFLQAW SAALAGELQS QGVDVELVIS YLVTSAMSKI RRASLSIPSP KNFVRATLNG IGRRNGAQER YATSTPYWAH ALMHFGIDQT VGVYSKLANS LNLNMHKSIR ARALKKAARL AAEKKD. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA reductase (PICST_79198), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
