Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serine/threonine-protein kinase US3 homolog (66) Recombinant Protein | ORF66 recombinant protein

Recombinant Varicella-zoster virus Serine/threonine-protein kinase US3 homolog (66)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase US3 homolog (66); Recombinant Varicella-zoster virus Serine/threonine-protein kinase US3 homolog (66); Recombinant Serine/threonine-protein kinase US3 homolog (66); Serine/threonine-protein kinase US3 homolog; Protein kinase ORF66 EC= 2.7.11.1; ORF66 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393aa; full length protein
Sequence
MNDVDATDTFVGQGKFRGAISTSPSHIMQTCGFIQQMFPVEMSPGIESEDDPNYDVNMDI QSFNIFDGVHETEAEASVALCAEARVGINKAGFVILKTFTPGAEGFAFACMDSKTCEHVV IKAGQRQGTATEATVLRALTHPSVVQLKGTFTYNKMTCLILPRYRTDLYCYLAAKRNLPI CDILAIQRSVLRALQYLHNNSIIHRDIKSENIFINHPGDVCVGDFGAACFPVDINANRYY GWAGTIATNSPELLARDPYGPAVDIWSAGIVLFEMATGQNSLFERDGLDGNCDSERQIKL IIRRSGTHPNEFPINPTSNLRRQYIGLAKRSSRKPGSRPLWTNLYELPIDLEYLICKMLS FDARHRPSAEVLLNHSVFQTLPDPYPNPMEVGD
Sequence Length
393
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,680 Da
NCBI Official Full Name
serine/threonine protein kinase US3
NCBI Official Symbol
ORF66
NCBI Protein Information
tegument protein; phosphorylates nuclear egress lamina protein; mediates phosphorylation of HDAC1 and HDAC2 and other cellular and viral proteins; serine/threonine protein kinase US3
UniProt Protein Name
Serine/threonine-protein kinase US3 homolog
Protein Family
UniProt Gene Name
66
UniProt Entry Name
US03_VZVD

Uniprot Description

Function: Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and inhibition of apoptosis. Phosphorylates proteins 24 and 27, two critical regulators of capsid budding from nucleus to endoplasmic reticulum, thereby facilitating virion egress. Modulates and redistributes host components of the nuclear envelope, including LMNA, emerin/EMD and the nuclear matrix protein MATR3. Phosphorylates envelope glycoprotein B (gB), probably to direct it to the cell surface. Promotes virus intracellular spread by restructuring host cell cytoskeleton. Blocks host apoptosis to extend cell survival and allow efficient viral replication. Promotes viral gene expression by phosphorylating host HDAC2 to reduce viral genome silencing

By similarity. Downregulates class I major histocompatibility complex (MHC-I) surface expression. Additionally, phosphorylates IE62 and targets it to the cytoplasm. The nuclear exclusion of IE62 enables the packaging of abundant levels of IE62 into virions. Ref.5 Ref.6 Ref.7 Ref.8

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Subcellular location: Host cytoplasm

By similarity. Host nucleus

By similarity.

Post-translational modification: Phosphorylated by ORF47; this phosphorylation regulates subsequent phosphorylation of proteins 24 and 27 by ORF66. Autophosphorylated

By similarity. Ref.4 Ref.8

Sequence similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.Contains 1 protein kinase domain.

Research Articles on ORF66

Similar Products

Product Notes

The ORF66 66 (Catalog #AAA1117686) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393aa; full length protein. The amino acid sequence is listed below: MNDVDATDTF VGQGKFRGAI STSPSHIMQT CGFIQQMFPV EMSPGIESED DPNYDVNMDI QSFNIFDGVH ETEAEASVAL CAEARVGINK AGFVILKTFT PGAEGFAFAC MDSKTCEHVV IKAGQRQGTA TEATVLRALT HPSVVQLKGT FTYNKMTCLI LPRYRTDLYC YLAAKRNLPI CDILAIQRSV LRALQYLHNN SIIHRDIKSE NIFINHPGDV CVGDFGAACF PVDINANRYY GWAGTIATNS PELLARDPYG PAVDIWSAGI VLFEMATGQN SLFERDGLDG NCDSERQIKL IIRRSGTHPN EFPINPTSNL RRQYIGLAKR SSRKPGSRPL WTNLYELPID LEYLICKMLS FDARHRPSAE VLLNHSVFQT LPDPYPNPME VGD. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase US3 homolog (66), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.