Integrin beta-PS (mys) Recombinant Protein | mys recombinant protein

Recombinant Drosophila melanogaster Integrin beta-PS (mys), partial

Cat. Num. AAA1116413

• Gene Names: mys; beta integrin; beta-int; beta-Int; beta-integrin; beta-PS; beta1; betaInt; betamys; betaPS; BetaPS; betaPS Int; betaPS integrin; BetaPS-Int; betaPS-integrin; betaPS1; beta[[mys]]; beta[[PS]]; beta[[PS]]-integrin; beta[[P]]S; bPS; b[[PS]]; CG1560; CT40473
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Integrin beta-PS (mys); Recombinant Drosophila melanogaster Integrin beta-PS (mys); partial; mys recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 180-423. Partial
• Sequence: AEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKKLEHPCENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQDYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSV

• Species: Drosophila melanogaster (Fruit fly)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 665390208
• NCBI GeneID: 44885
• NCBI Accession #: NP_001284998.1
• NCBI GenBank Nucleotide #: NM_001298069.1
• UniProt Accession #: P11584; Q8MYX9; Q9W3L2
• Molecular Weight: 92,656 Da
• NCBI Official Full Name: myospheroid, isoform C
• NCBI Official Synonym Full Names: myospheroid
• NCBI Official Symbol: mys
• NCBI Official Synonym Symbols: beta integrin; beta-int; beta-Int; beta-integrin; beta-PS; beta1; betaInt; betamys; betaPS; BetaPS; betaPS Int; betaPS integrin; BetaPS-Int; betaPS-integrin; betaPS1; beta[[mys]]; beta[[PS]]; beta[[PS]]-integrin; beta[[P]]S; bPS; b[[PS]]; CG1560; CT40473;
• NCBI Protein Information: CG1560 gene product from transcript CG1560-RD
• UniProt Protein Name: Integrin beta-PS
• Protein Family: Integrin
• UniProt Gene Name: mys
• UniProt Synonym Gene Names: l(1)mys; olfC

Uniprot Description

Integrin alpha-PS1/beta-PS is a receptor for laminin (PubMed:7972082). Integrin alpha-PS2/beta-PS is a receptor for Tig, wb and Ten-m (PubMed:7924982, PubMed:7972082, PubMed:9660786). Contributes to endodermal integrity and adhesion between the midgut epithelium and the surrounding visceral muscle (PubMed:15469969). Essential for migration of the primordial midgut cells and for maintaining, but not establishing, cell polarity in the midgut epithelium (PubMed:15469969). The two beta subunits mediate midgut migration by distinct mechanisms: beta-PS requires rhea/talin and Itgbn does not (PubMed:15469969). Required for rhea/talin correct cellular localization in the midgut (PubMed:15469969). Required for many embryonic (dorsal closure and somatic muscle attachments) and postembryonic developmental processes (attachment between cell layers of imaginal disks, organization of ommatidial arrays and flight muscle development) (PubMed:8119134, PubMed:7924982, PubMed:7972082, PubMed:10821184). Involved in the function and/or development of the olfactory system (PubMed:10821184). In the testes, essential for shv-dependent maintenance of somatic hub cells and their localization to the apical tip (PubMed:27191715). Plays a role in timely border cell migration during oogenesis (PubMed:19035354).