Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Negative modulator of initiation of replication (seqA) Recombinant Protein | seqA recombinant protein

Recombinant Aeromonas hydrophila subsp. hydrophila Negative modulator of initiation of replication (seqA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Negative modulator of initiation of replication (seqA); Recombinant Aeromonas hydrophila subsp. hydrophila Negative modulator of initiation of replication (seqA); seqA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-169, Full length protein
Sequence
MKTIELDDDLYFYIASQTRHIGESASDILRRLLEQPANQAAPVTEPVTTAQPHTVADAMGLEALLDSGELQKEEKSINRFMQVLSTLYRDDPVGFTQATEIKGRKRVYFSRDPDALRASGSTTKPKPVPETPFWVITNTNTSRKQNMVAQLMTSMGYGDEVIARVCGAI
Sequence Length
169
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,780 Da
NCBI Official Full Name
SeqA protein
NCBI Official Symbol
AHA_1536
NCBI Protein Information
SeqA protein
UniProt Protein Name
Negative modulator of initiation of replication
UniProt Gene Name
seqA

Uniprot Description

Negative regulator of replication initiation, which contributes to regulation of DNA replication and ensures that replication initiation occurs exactly once per chromosome per cell cycle. Binds to pairs of hemimethylated GATC sequences in the oriC region, thus preventing assembly of replication proteins and re-initiation at newly replicated origins. Repression is relieved when the region becomes fully methylated.

Similar Products

Product Notes

The seqA seqa (Catalog #AAA1115787) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-169, Full length protein. The amino acid sequence is listed below: MKTIELDDDL YFYIASQTRH IGESASDILR RLLEQPANQA APVTEPVTTA QPHTVADAMG LEALLDSGEL QKEEKSINRF MQVLSTLYRD DPVGFTQATE IKGRKRVYFS RDPDALRASG STTKPKPVPE TPFWVITNTN TSRKQNMVAQ LMTSMGYGDE VIARVCGAI. It is sometimes possible for the material contained within the vial of "Negative modulator of initiation of replication (seqA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.