Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chloride intracellular channel protein 1 (CLIC1) Recombinant Protein | CLIC1 recombinant protein

Recombinant Human Chloride intracellular channel protein 1 (CLIC1)

Gene Names
CLIC1; G6; NCC27
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chloride intracellular channel protein 1 (CLIC1); Recombinant Human Chloride intracellular channel protein 1 (CLIC1); Recombinant Chloride intracellular channel protein 1 (CLIC1); Chloride intracellular channel protein 1; Chloride channel ABP Nuclear chloride ion channel 27; NCC27 Regulatory nuclear chloride ion channel protein; hRNCC; CLIC1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-241
Sequence
AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Sequence Length
241
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,923 Da
NCBI Official Full Name
chloride intracellular channel protein 1
NCBI Official Synonym Full Names
chloride intracellular channel 1
NCBI Official Symbol
CLIC1
NCBI Official Synonym Symbols
G6; NCC27
NCBI Protein Information
chloride intracellular channel protein 1; hRNCC; p64CLCP; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein
UniProt Protein Name
Chloride intracellular channel protein 1
UniProt Gene Name
CLIC1
UniProt Synonym Gene Names
G6; NCC27; NCC27; hRNCC
UniProt Entry Name
CLIC1_HUMAN

NCBI Description

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]

Uniprot Description

CLIC1: Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Involved in regulation of the cell cycle. Belongs to the chloride channel CLIC family.

Protein type: Membrane protein, integral; Channel, chloride

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: extracellular space; nuclear membrane; membrane; mitochondrion; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nuclear envelope; nucleus; brush border; vesicle

Molecular Function: protein binding; chloride channel activity; voltage-gated ion channel activity

Biological Process: positive regulation of osteoblast differentiation; regulation of mitochondrial membrane potential; regulation of cell cycle; chloride transport; signal transduction

Research Articles on CLIC1

Similar Products

Product Notes

The CLIC1 clic1 (Catalog #AAA1109393) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-241. The amino acid sequence is listed below: AEEQPQVELF VKAGSDGAKI GNCPFSQRLF MVLWLKGVTF NVTTVDTKRR TETVQKLCPG GQLPFLLYGT EVHTDTNKIE EFLEAVLCPP RYPKLAALNP ESNTAGLDIF AKFSAYIKNS NPALNDNLEK GLLKALKVLD NYLTSPLPEE VDETSAEDEG VSQRKFLDGN ELTLADCNLL PKLHIVQVVC KKYRGFTIPE AFRGVHRYLS NAYAREEFAS TCPDDEEIEL AYEQVAKALK. It is sometimes possible for the material contained within the vial of "Chloride intracellular channel protein 1 (CLIC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.