Anaerobic C4-dicarboxylate transporter DcuB (dcuB) Recombinant Protein | dcuB recombinant protein
Recombinant Escherichia coli Anaerobic C4-dicarboxylate transporter DcuB (dcuB), partial
Gene Names
dcuB; ECK4116; genF; JW4084
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Anaerobic C4-dicarboxylate transporter DcuB (dcuB); Recombinant Escherichia coli Anaerobic C4-dicarboxylate transporter DcuB (dcuB); partial; dcuB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-446
Sequence
MLFTIQLIIILICLFYGARKGGIALGLLGGIGLVILVFVFHLQPGKPPVDVMLVIIAVVAASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTILCGTGHVVYTILPIIYDVAIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLGNVTFDGRHLEFLDLLAITIPSTLIGILAIGIFSWFRGKDLDKDEEFQKFISVPENREYVYGDTATLLDKKLPKSNWLAMWIFLGAIAVVALLGADSDLRPSFGGKPLSMVLVIQMFMLLTGALIIILTKTNPASISKNEVFRSGMIAIVAVYGIAWMAETMFGAHMSEIQGVLGEMVKEYPWAYAIVLLLVSKFVNSQAAALAAIVPVALAIGVDPAYIVASAPACYGYYILPTYPSDLAAIQFDRSGTTHIGRFVINHSFILPGLIGVSVSCVFGWIFAAMYGFL
Sequence Length
446
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,935 Da
NCBI Official Full Name
C4-dicarboxylate transporter, anaerobic; DcuS co-sensor
NCBI Official Symbol
dcuB
NCBI Official Synonym Symbols
ECK4116; genF; JW4084
NCBI Protein Information
C4-dicarboxylate transporter, anaerobic; DcuS co-sensor
UniProt Protein Name
Anaerobic C4-dicarboxylate transporter DcuB
Protein Family
UniProt Gene Name
dcuB
UniProt Synonym Gene Names
genF
NCBI Description
IT (Ion Transporter) superfamily (Prakash, 2003). [More information is available at EcoGene: EG10006]. The DcuB transporter is one of three transporters known to be responsible for the uptake of C4-dicarboxylates such as fumarate under anaerobic conditions. [More information is available at EcoCyc: EG10006].
Uniprot Description
Responsible for the transport of C4-dicarboxylates from the periplasm across the inner membrane.
Research Articles on dcuB
Similar Products
Product Notes
The dcuB dcub (Catalog #AAA1105180) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-446. The amino acid sequence is listed below: MLFTIQLIII LICLFYGARK GGIALGLLGG IGLVILVFVF HLQPGKPPVD VMLVIIAVVA ASATLQASGG LDVMLQIAEK LLRRNPKYVS IVAPFVTCTL TILCGTGHVV YTILPIIYDV AIKNNIRPER PMAASSIGAQ MGIIASPVSV AVVSLVAMLG NVTFDGRHLE FLDLLAITIP STLIGILAIG IFSWFRGKDL DKDEEFQKFI SVPENREYVY GDTATLLDKK LPKSNWLAMW IFLGAIAVVA LLGADSDLRP SFGGKPLSMV LVIQMFMLLT GALIIILTKT NPASISKNEV FRSGMIAIVA VYGIAWMAET MFGAHMSEIQ GVLGEMVKEY PWAYAIVLLL VSKFVNSQAA ALAAIVPVAL AIGVDPAYIV ASAPACYGYY ILPTYPSDLA AIQFDRSGTT HIGRFVINHS FILPGLIGVS VSCVFGWIFA AMYGFL. It is sometimes possible for the material contained within the vial of "Anaerobic C4-dicarboxylate transporter DcuB (dcuB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
