TVP38/TMEM64 family membrane protein ydjX (ydjX) Recombinant Protein | ydjX recombinant protein
Recombinant Escherichia coli TVP38/TMEM64 family membrane protein ydjX (ydjX)
Gene Names
ydjX; ECK1748; JW1739
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TVP38/TMEM64 family membrane protein ydjX (ydjX); Recombinant Escherichia coli TVP38/TMEM64 family membrane protein ydjX (ydjX); Recombinant TVP38/TMEM64 family membrane protein ydjX (ydjX); TVP38/TMEM64 family membrane protein ydjX; ydjX recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-236
Sequence
MNAERKFLFACLIFALVIYAIHAFGLFDLLTDLPHLQTLIRQSGFFGYSLYILLFIIATLLLLPGSILVIAGGIVFGPLLGTLLSLIAATLASSCSFLLARWLGRDLLLKYVGHSNTFQAIEKGIARNGIDFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTLISALTTLPGIVIYTVMASDLANEGITLRFILQLCLAGLALFILVQLAKLYARHKHVDLSASRRSPLTHPKNEG
Sequence Length
236
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,058 Da
NCBI Official Full Name
inner membrane protein, TVP38/TMEM64 family
NCBI Official Symbol
ydjX
NCBI Official Synonym Symbols
ECK1748; JW1739
NCBI Protein Information
inner membrane protein, TVP38/TMEM64 family
UniProt Protein Name
TVP38/TMEM64 family membrane protein YdjX
Protein Family
UniProt Gene Name
ydjX
UniProt Entry Name
YDJX_ECOLI
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the TVP38/TMEM64 family.
Similar Products
Product Notes
The ydjX ydjx (Catalog #AAA1101316) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-236. The amino acid sequence is listed below: MNAERKFLFA CLIFALVIYA IHAFGLFDLL TDLPHLQTLI RQSGFFGYSL YILLFIIATL LLLPGSILVI AGGIVFGPLL GTLLSLIAAT LASSCSFLLA RWLGRDLLLK YVGHSNTFQA IEKGIARNGI DFLILTRLIP LFPYNIQNYA YGLTTIAFWP YTLISALTTL PGIVIYTVMA SDLANEGITL RFILQLCLAG LALFILVQLA KLYARHKHVD LSASRRSPLT HPKNEG. It is sometimes possible for the material contained within the vial of "TVP38/TMEM64 family membrane protein ydjX (ydjX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
