Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein UL20 homolog (41) Recombinant Protein | ORF41 recombinant protein

Recombinant Equine herpesvirus 1 Protein UL20 homolog (41)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein UL20 homolog (41); Recombinant Equine herpesvirus 1 Protein UL20 homolog (41); Recombinant Protein UL20 homolog (41); Protein UL20 homolog; ORF41 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-239
Sequence
MPQVLMGNTRLHAPLEDGIPLIENDENSSQNEVDLYDYVSMSSYGGDNDFLISSAGGNITPENRPSFSAHVVLFAISALVIKPVCCFIFLNHYVITGSYDFAVAGGVCTVLYYMRLALTAWFMFRNIQSDMLPLNVWQQFVIGCMALGRTVAFMVVSYTTLFIRSELFFSMLAPNAGREYITPIIAHKLMPLISVRSAVCLVIISTAVYAADAICDTIGFTLPRMWMCILMRSSSVKRS
Sequence Length
239
Species
Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,535 Da
NCBI Official Full Name
envelope protein UL20
NCBI Official Symbol
ORF41
NCBI Protein Information
type 3 membrane protein; 4 transmembrane domains; envelope protein UL20
UniProt Protein Name
Protein UL20 homolog
UniProt Entry Name
UL20_EHV1V

Uniprot Description

Function: Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes

By similarity.

Subunit structure: Interacts with gK (via N-terminus); this interaction plays a role in the coordinate transport of UL20 and gK to the trans-Golgi network (TGN), and is required for their cell surface expression. Interacts with gB

By similarity.

Subcellular location: Virion

By similarity. Host cell membrane; Multi-pass membrane protein

By similarity. Host endosome membrane; Multi-pass membrane protein

By similarity. Host Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Host nucleus membrane; Multi-pass membrane protein

By similarity. Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with gK to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN)

By similarity.

Sequence similarities: Belongs to the alphaherpesvirinae UL20 family.

Similar Products

Product Notes

The ORF41 (Catalog #AAA1093626) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-239. The amino acid sequence is listed below: MPQVLMGNTR LHAPLEDGIP LIENDENSSQ NEVDLYDYVS MSSYGGDNDF LISSAGGNIT PENRPSFSAH VVLFAISALV IKPVCCFIFL NHYVITGSYD FAVAGGVCTV LYYMRLALTA WFMFRNIQSD MLPLNVWQQF VIGCMALGRT VAFMVVSYTT LFIRSELFFS MLAPNAGREY ITPIIAHKLM PLISVRSAVC LVIISTAVYA ADAICDTIGF TLPRMWMCIL MRSSSVKRS. It is sometimes possible for the material contained within the vial of "Protein UL20 homolog (41), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.