Cytochrome c oxidase subunit 1 (COX1) Recombinant Protein | cox1 recombinant protein
Recombinant Debaryomyces hansenii Cytochrome c oxidase subunit 1 (COX1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 1 (COX1); Recombinant Debaryomyces hansenii Cytochrome c oxidase subunit 1 (COX1); cox1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-536
Sequence
MKQMSYVTRWLYSTSHKDIGMTYLGFGMLSAMMGTGMSVMMRMELSNGNSQFFHGNNQAFNVMMSGHALLMMFFFIMPVWMGAFGNFFLPMLMGAADMAFARLNNISFWCLPPALVCMVCSVLMEQGAGTGFTTYPPLSSMSAHSGPSVDLAMFAMHLTSMSSLLGAMNFMVTVLNMRTMGLHMVNMPLFAWAMFLTAMLLLLSLPVLTAAVTLLLMDRNFNTGFYEVGAGGDPVTYEHLFWFFGHPEVYILMMPGFGVMSHMVSTYSKKPMFGEMGMLYAMGSIGFLGFLVWSHHMFVVGLDIDSRAYFTSATMVIAVPTGIKIFSWLATIYGGELRLGVPMLFALGFLFLFTMGGLTGVMTSNASMDVAFHDTYYVVGHFHYVLSMGALFSLMGAYYYWGPAMFGLKYNRMLGEMHFWLLFMSVNVMFLPMHFLGLNGMPRRMPQYPDAFMGWNYMSSMGSAMSVMSVLVGLKSVLVQLENGENEELEMQVTPDFTESNLNREIRDSDLDLILTRPAEYHTYSELPVLTSNSHA
Sequence Length
536
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for cox1 recombinant protein
COX1
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,959 Da
NCBI Official Full Name
cytochrome c oxidase subunit 1
NCBI Official Symbol
cox1
NCBI Protein Information
cytochrome c oxidase subunit 1; endonuclease
UniProt Protein Name
Cytochrome c oxidase subunit 1
UniProt Gene Name
COX1
UniProt Entry Name
COX1_DEBHA
Uniprot Description
Function: Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
By similarity.
Catalytic activity: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
Pathway: Energy metabolism; oxidative phosphorylation.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the heme-copper respiratory oxidase family.
Similar Products
Product Notes
The cox1 cox1 (Catalog #AAA1090797) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-536. The amino acid sequence is listed below: MKQMSYVTRW LYSTSHKDIG MTYLGFGMLS AMMGTGMSVM MRMELSNGNS QFFHGNNQAF NVMMSGHALL MMFFFIMPVW MGAFGNFFLP MLMGAADMAF ARLNNISFWC LPPALVCMVC SVLMEQGAGT GFTTYPPLSS MSAHSGPSVD LAMFAMHLTS MSSLLGAMNF MVTVLNMRTM GLHMVNMPLF AWAMFLTAML LLLSLPVLTA AVTLLLMDRN FNTGFYEVGA GGDPVTYEHL FWFFGHPEVY ILMMPGFGVM SHMVSTYSKK PMFGEMGMLY AMGSIGFLGF LVWSHHMFVV GLDIDSRAYF TSATMVIAVP TGIKIFSWLA TIYGGELRLG VPMLFALGFL FLFTMGGLTG VMTSNASMDV AFHDTYYVVG HFHYVLSMGA LFSLMGAYYY WGPAMFGLKY NRMLGEMHFW LLFMSVNVMF LPMHFLGLNG MPRRMPQYPD AFMGWNYMSS MGSAMSVMSV LVGLKSVLVQ LENGENEELE MQVTPDFTES NLNREIRDSD LDLILTRPAE YHTYSELPVL TSNSHA. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 1 (COX1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
