Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

High frequency lysogenization protein HflD homolog (hflD) Recombinant Protein | hflD recombinant protein

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B High frequency lysogenization protein HflD homolog (hflD)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High frequency lysogenization protein HflD homolog (hflD); Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B High frequency lysogenization protein HflD homolog (hflD); hflD recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208, Full length protein
Sequence
MAKNYYDITLALAGICQSARLVQQLAHEGQCDNDALNTVLSGLLQTNPPSTLAVYGGNEQSLKMGLETLQSVLNANRQGPAAELTRYTLSLMVLERKLNANKSAMNTLGDRISQLDRQLAHFDLESETMMSSLAAIYTDVISPLGPRIQVIGSPAILQSTLVQAKIRATLLAGIRSAVLWQQVGGSRLQLMFSRNRLFKQAQSILAHI
Sequence Length
208
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,664 Da
NCBI Official Full Name
lysogenization protein HflD
UniProt Protein Name
High frequency lysogenization protein HflD homolog
UniProt Gene Name
hflD

Similar Products

Product Notes

The hflD hfld (Catalog #AAA1079011) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208, Full length protein. The amino acid sequence is listed below: MAKNYYDITL ALAGICQSAR LVQQLAHEGQ CDNDALNTVL SGLLQTNPPS TLAVYGGNEQ SLKMGLETLQ SVLNANRQGP AAELTRYTLS LMVLERKLNA NKSAMNTLGD RISQLDRQLA HFDLESETMM SSLAAIYTDV ISPLGPRIQV IGSPAILQST LVQAKIRATL LAGIRSAVLW QQVGGSRLQL MFSRNRLFKQ AQSILAHI. It is sometimes possible for the material contained within the vial of "High frequency lysogenization protein HflD homolog (hflD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.