Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Attachment protein G3P (III) Recombinant Protein | III recombinant protein

Recombinant Enterobacteria phage If1 Attachment protein G3P (III)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Attachment protein G3P (III); Recombinant Enterobacteria phage If1 Attachment protein G3P (III); Recombinant Attachment protein G3P (III); Attachment protein G3P; Gene 3 protein; G3P Minor coat protein; III recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-460
Sequence
ATTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSCNGHWTPVRAADGSGNGGDDNSSGGGSNGDSGNNSTPDTVTPGQTVNLPSDLSTLSIPANVVKSDSIGSQFSLYTNASCTMCSGYYLSNNADSIAIANITETVKADYNQPDMWFEQTDSDGNHVKILQNSYKAVSYNVESKQSDVNNPTYINYSYSVNVKQVSYDTSNVCIMNWETFQNKCDASRAVLITDTVTPSYSRNITIQSNINYQGSNGSGGSGGSGGSGNDGGGTGNNGNGTGDFDYVKMANANKDALTESFDLSALQADTGASLDGSVQGTLDSLSGFSDSIGGLVGNGSAISGEFAGSSAAMNAIGEGDKSPLLDSLSFLKDGLFPALPEFKQCTPFVFAPGKEYEFIIECKYIDMFKGIFAFILYFWTFVTVYDSFSGILRKGRG
Sequence Length
460
Species
Enterobacteria phage If1 (Bacteriophage If1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,790 Da
NCBI Official Full Name
attachment protein
NCBI Official Symbol
III
NCBI Protein Information
attachment protein
UniProt Protein Name
Attachment protein G3P
Protein Family
UniProt Gene Name
III
UniProt Synonym Gene Names
G3P
UniProt Entry Name
G3P_BPIF1

Uniprot Description

Function: Plays essential roles both in the entry of the viral genome into the bacterial host and in the budding process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the host I-pilus. Subsequent interaction with the host coreceptor tolA induces injection of the viral DNA into the host cytoplasm. In the budding process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain

By similarity.

Subunit structure: Interacts with G6P; this interaction is required for proper integration of G3P and G6P into the virion. Interacts with G8P

By similarity. Interacts with host tolA

By similarity.

Subcellular location: Virion

Potential. Host membrane; Single-pass type I membrane protein

Potential. Note: Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Sequence similarities: Belongs to the inovirus G3P protein family.

Similar Products

Product Notes

The III iii (Catalog #AAA1078819) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-460. The amino acid sequence is listed below: ATTDAECLSK PAFDGTLSNV WKEGDSRYAN FENCIYELSG IGIGYDNDTS CNGHWTPVRA ADGSGNGGDD NSSGGGSNGD SGNNSTPDTV TPGQTVNLPS DLSTLSIPAN VVKSDSIGSQ FSLYTNASCT MCSGYYLSNN ADSIAIANIT ETVKADYNQP DMWFEQTDSD GNHVKILQNS YKAVSYNVES KQSDVNNPTY INYSYSVNVK QVSYDTSNVC IMNWETFQNK CDASRAVLIT DTVTPSYSRN ITIQSNINYQ GSNGSGGSGG SGGSGNDGGG TGNNGNGTGD FDYVKMANAN KDALTESFDL SALQADTGAS LDGSVQGTLD SLSGFSDSIG GLVGNGSAIS GEFAGSSAAM NAIGEGDKSP LLDSLSFLKD GLFPALPEFK QCTPFVFAPG KEYEFIIECK YIDMFKGIFA FILYFWTFVT VYDSFSGILR KGRG. It is sometimes possible for the material contained within the vial of "Attachment protein G3P (III), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.