Probable histone H2AXa (At1g08880) Recombinant Protein | At1g08880 recombinant protein

Recombinant Arabidopsis thaliana Probable histone H2AXa (At1g08880)

Cat. Num. AAA1078282

• Gene Names: H2AXA; F7G19.24; F7G19_24; G-H2AX; GAMMA H2AX; gamma histone variant H2AX; GAMMA-H2AX; histone H2A 5; HTA5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable histone H2AXa (At1g08880); Recombinant Arabidopsis thaliana Probable histone H2AXa (At1g08880); At1g08880 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-142, Full length protein
• Sequence: MSTGAGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKSGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPSKVGKNKGDIGSASQEF
• Sequence Length: 142

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15223948
• NCBI GeneID: 837409
• NCBI Accession #: NP_172363.1
• NCBI GenBank Nucleotide #: NM_100760.5
• UniProt Accession #: O04848; Q8LAC0
• Molecular Weight: 14,813 Da
• NCBI Official Full Name: Histone superfamily protein
• NCBI Official Symbol: H2AXA
• NCBI Official Synonym Symbols: F7G19.24; F7G19_24; G-H2AX; GAMMA H2AX; gamma histone variant H2AX; GAMMA-H2AX; histone H2A 5; HTA5
• NCBI Protein Information: Histone superfamily protein
• UniProt Protein Name: Probable histone H2AXa
• UniProt Gene Name: At1g08880

NCBI Description

Encodes HTA5, a histone H2A protein. H2AX is a meiosis-specific isoform of histone H2A. Upon DSB formation, rapid accumulation of phosphorylated H2AX (gamma-H2AX) occurs around the break site. #H2AX foci accumulate in early G2. Immunolocalization studies in spread preparations of wild-type meiocytes at G2/early leptotene revealed the accumulation of numerous rather diffuse gamma-H2AX foci throughout the chromatin. However, their accumulation is not contemporaneous with that of AtSPO11-1. At 3 h post-S, no gamma-H2AX foci are detected. During the 3- to 5-h window when AtSPO11-1 foci rapidly disappear, there is an equally swift accumulation of gamma-H2AX to a maximum of >50 diffuse foci. The level of gammaH2AX then remains constant for a further 13 h before undergoing a gradual decrease to 10#Aei20 foci in the 18- to 24-h post-S period. By 30 h the foci have disappeared from the chromatin.

Uniprot Description

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation ().