Eppin (SPINLW1) Recombinant Protein | SPINLW1 recombinant protein
Recombinant Human Eppin (SPINLW1)
Gene Names
EPPIN-WFDC6; SPINLW1-WFDC6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eppin (SPINLW1); Recombinant Human Eppin (SPINLW1); SPINLW1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-133, Full length protein
Sequence
PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Sequence Length
112
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SPINLW1 recombinant protein
This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,486 Da
NCBI Official Full Name
SPINLW1-WFDC6 fusion protein
NCBI Official Synonym Full Names
EPPIN-WFDC6 readthrough
NCBI Official Symbol
EPPIN-WFDC6
NCBI Official Synonym Symbols
SPINLW1-WFDC6
NCBI Protein Information
SPINLW1-WFDC6 fusion protein
UniProt Protein Name
Eppin
UniProt Gene Name
EPPIN
UniProt Synonym Gene Names
SPINLW1; WAP7; WFDC7; CT71
NCBI Description
This locus represents naturally occurring read-through transcription between the neighboring SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) and WFDC6 (WAP four-disulfide core domain 6) genes. The read-through transcript encodes a fusion protein that shares sequence identity with the products of each individual gene. [provided by RefSeq, Nov 2010]
Uniprot Description
Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.
Similar Products
Product Notes
The SPINLW1 eppin (Catalog #AAA1077237) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-133, Full length protein. The amino acid sequence is listed below: PGLTDWLFPR RCPKIREECE FQERDVCTKD RQCQDNKKCC VFSCGKKCLD LKQDVCEMPK ETGPCLAYFL HWWYDKKDNT CSMFVYGGCQ GNNNNFQSKA NCLNTCKNKR FP. It is sometimes possible for the material contained within the vial of "Eppin (SPINLW1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
