Putative ABC transporter periplasmic-binding protein ydcS (ydcS) Recombinant Protein | ydcS recombinant protein
Recombinant Escherichia coli Putative ABC transporter periplasmic-binding protein ydcS (ydcS)
Gene Names
ydcS; ECK1434; JW1435
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative ABC transporter periplasmic-binding protein ydcS (ydcS); Recombinant Escherichia coli Putative ABC transporter periplasmic-binding protein ydcS (ydcS); ydcS recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-381, full length protein
Sequence
AEPPTNLDKPEGRLDIIAWPGYIERGQTDKQYDWVTQFEKETGCAVNVKTAATSDEMVSLMTKGGYDLVTASGDASLRLIMGKRVQPINTALIPNWKTLDPRVVKGDWFNVGGKVYGTPYQWGPNLLMYNTKTFPTPPDSWQVVFVEQNLPDGKSNKGRVQAYDGPIYIADAALFVKATQPQLGISDPYQLTEEQYQAVLKVLRAQHSLIHRYWHDTTVQMSDFKNEGVVASSAWPYQANALKAEGQPVATVFPKEGVTGWADTTMLHSEAKHPVCAYKWMNWSLTPKVQGDVAAWFGSLPVVPEGCKASPLLGEKGCETNGFNYFDKIAFWKTPIAEGGKFVPYSRWTQDYIAIMGGR
Sequence Length
359
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,295 Da
NCBI Official Full Name
putative ABC transporter periplasmic binding protein
NCBI Official Symbol
ydcS
NCBI Official Synonym Symbols
ECK1434; JW1435
NCBI Protein Information
putative ABC transporter periplasmic binding protein
UniProt Protein Name
Putative ABC transporter periplasmic-binding protein YdcS
Protein Family
UniProt Gene Name
ydcS
NCBI Description
YdcS was purified and characterized as a PHB synthase, however most PHB remains so there must be another synthase(s) (Dai, 2008). [More information is available at EcoGene: EG13762]. YdcS is a periplasmic binding protein of a predicted spermidine/putrescine ABC transporter. [More information is available at EcoCyc: G6751].
Uniprot Description
Probably part of the binding-protein-dependent transport system YdcSTUV.
Research Articles on ydcS
Similar Products
Product Notes
The ydcS ydcs (Catalog #AAA1066707) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-381, full length protein. The amino acid sequence is listed below: AEPPTNLDKP EGRLDIIAWP GYIERGQTDK QYDWVTQFEK ETGCAVNVKT AATSDEMVSL MTKGGYDLVT ASGDASLRLI MGKRVQPINT ALIPNWKTLD PRVVKGDWFN VGGKVYGTPY QWGPNLLMYN TKTFPTPPDS WQVVFVEQNL PDGKSNKGRV QAYDGPIYIA DAALFVKATQ PQLGISDPYQ LTEEQYQAVL KVLRAQHSLI HRYWHDTTVQ MSDFKNEGVV ASSAWPYQAN ALKAEGQPVA TVFPKEGVTG WADTTMLHSE AKHPVCAYKW MNWSLTPKVQ GDVAAWFGSL PVVPEGCKAS PLLGEKGCET NGFNYFDKIA FWKTPIAEGG KFVPYSRWTQ DYIAIMGGR. It is sometimes possible for the material contained within the vial of "Putative ABC transporter periplasmic-binding protein ydcS (ydcS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
