Non-structural maintenance of chromosome element 4 (NSE4) Recombinant Protein | NSE4 recombinant protein
Recombinant Saccharomyces cerevisiae Non-structural maintenance of chromosome element 4 (NSE4)
Gene Names
NSE4; QRI2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural maintenance of chromosome element 4 (NSE4); Recombinant Saccharomyces cerevisiae Non-structural maintenance of chromosome element 4 (NSE4); NSE4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-402, full length protein
Sequence
MSSTVISRKRRNSTVTEPDSSGETRKQKKSRSDEKSSSSKDGDPQLEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVIGIKNNGLFAHDARAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRYMLKEHFKLNNIAENRNDLTLAADEQSAADQQEESDGDIDRTPDDNHTDKATSSFKATSMRHSYLQQFSHYNEFSQFNWFRIGALYNTISKNAPITDHLMGPLSIEKKPRVLTQRRRNNDQVGEKITAEKITQHSLNSTQQETTPEQVKKCFKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLMEHDEEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIKKYNITSPFLD
Sequence Length
402
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,121 Da
NCBI Official Full Name
Smc5-Smc6 complex subunit NSE4
NCBI Official Symbol
NSE4
NCBI Official Synonym Symbols
QRI2
NCBI Protein Information
Smc5-Smc6 complex subunit NSE4
UniProt Protein Name
Non-structural maintenance of chromosome element 4
Protein Family
UniProt Gene Name
NSE4
UniProt Synonym Gene Names
QRI2; Non-SMC element 4
Uniprot Description
Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks.
Research Articles on NSE4
Similar Products
Product Notes
The NSE4 nse4 (Catalog #AAA1063740) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-402, full length protein. The amino acid sequence is listed below: MSSTVISRKR RNSTVTEPDS SGETRKQKKS RSDEKSSSSK DGDPQLEFKV LQGYRDLESE MHKGRAQVTR TGDIGVAMDN LNAVDSLFNK VIGIKNNGLF AHDARAMVSI SELAQISVRN LKFDDSRSMV NLENIVNSLK RYMLKEHFKL NNIAENRNDL TLAADEQSAA DQQEESDGDI DRTPDDNHTD KATSSFKATS MRHSYLQQFS HYNEFSQFNW FRIGALYNTI SKNAPITDHL MGPLSIEKKP RVLTQRRRNN DQVGEKITAE KITQHSLNST QQETTPEQVK KCFKKLSKKL GPEGSINLFK FIIDPNSFSR SIENLFYTSF LIKEGKLLME HDEEGLPTIK IKQSISHTDS RSKEIERQRR RAAHQNHIIF QMDMPTWRKL IKKYNITSPF LD. It is sometimes possible for the material contained within the vial of "Non-structural maintenance of chromosome element 4 (NSE4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
