Chaperone protein DnaJ 1 (dnaJ1) Recombinant Protein | dnaJ1 recombinant protein
Recombinant Aquifex aeolicus Chaperone protein DnaJ 1 (dnaJ1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chaperone protein DnaJ 1 (dnaJ1); Recombinant Aquifex aeolicus Chaperone protein DnaJ 1 (dnaJ1); dnaJ1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-364, Full length
Sequence
MSQAVKDYYEILGVNRDATKEEIKKAYRKLVRIYHPDINPDPSAQEKFKEINEAYHVLIDDERRSEYDAILSRNDVGKFRDFLEYIQEFVESIIQGEKGKKRRPRKGQDIKMKLPLTLEEAGLGCEKEIIYSRWMDCPVCEGMGVKGEAETVVCHACNGEGRRVSGIFNFPRPCSVCKGKGFIVKNPCPTCYGRGRVSAQHKIKVHIPPGTEEGEVLKVPEKGHLGYFGGKPGDLYLKVVLKEHPIFKKVGKDLHMEKVVSFPLAVLGGTVKVPTLEGEEIDVFIQPGTECGATKVVKEKGYPYENGRGDLIIHIRIGVPKNLSKSERKLLEKLAESIKEEGEEVYREGGSLVEKLSSLFKKNA
Sequence Length
364
Species
Aquifex aeolicus (strain VF5)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,937 Da
NCBI Official Full Name
chaperone DnaJ
NCBI Official Symbol
dnaJ1
NCBI Protein Information
chaperone DnaJ
UniProt Protein Name
Chaperone protein DnaJ 1
Protein Family
UniProt Gene Name
dnaJ1
Uniprot Description
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Similar Products
Product Notes
The dnaJ1 dnaj1 (Catalog #AAA1060424) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364, Full length. The amino acid sequence is listed below: MSQAVKDYYE ILGVNRDATK EEIKKAYRKL VRIYHPDINP DPSAQEKFKE INEAYHVLID DERRSEYDAI LSRNDVGKFR DFLEYIQEFV ESIIQGEKGK KRRPRKGQDI KMKLPLTLEE AGLGCEKEII YSRWMDCPVC EGMGVKGEAE TVVCHACNGE GRRVSGIFNF PRPCSVCKGK GFIVKNPCPT CYGRGRVSAQ HKIKVHIPPG TEEGEVLKVP EKGHLGYFGG KPGDLYLKVV LKEHPIFKKV GKDLHMEKVV SFPLAVLGGT VKVPTLEGEE IDVFIQPGTE CGATKVVKEK GYPYENGRGD LIIHIRIGVP KNLSKSERKL LEKLAESIKE EGEEVYREGG SLVEKLSSLF KKNA. It is sometimes possible for the material contained within the vial of "Chaperone protein DnaJ 1 (dnaJ1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
