Protein Wnt-2 (wnt-2) Recombinant Protein | wnt-2\r recombinant protein

Recombinant Caenorhabditis elegans Protein Wnt-2 (wnt-2)

Cat. Num. AAA1058516

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein Wnt-2 (wnt-2); Recombinant Caenorhabditis elegans Protein Wnt-2 (wnt-2); wnt-2\r recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 38-360, Full length
• Sequence: AGHNVKPVCELPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDICK
• Sequence Length: 323

• Species: Caenorhabditis elegans
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 17539494
• NCBI GeneID: 177870
• NCBI Accession #: NP_501822.1
• NCBI GenBank Nucleotide #: NM_069421.4
• UniProt Accession #: P34889
• Molecular Weight: 40,436 Da
• NCBI Official Full Name: Protein Wnt-2
• NCBI Official Symbol: cwn-2
• NCBI Protein Information: Protein Wnt-2
• UniProt Protein Name: Protein Wnt-2
• UniProt Gene Name: cwn-2

Uniprot Description

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Involved in the correct positioning of the developing nerve ring and in axon guidance of SIA and SIB neurons, probably by binding to tyrosine kinase receptor cam-1 (PubMed:19855022). In addition, regulates the positioning of some head neuronal cells, muscle arms associated with the nerve ring and the excretory pore (PubMed:19855022). Together with Wnt ligand cwn-1, regulates the migration of CAN, ALM, BDU and HSN neurons during embryogenesis, the migration of QL and QR neuroblast descendants during larval development, and polarity of ALM neurons (PubMed:16109397, PubMed:16516839, PubMed:18622031, PubMed:25917219). May act through the wnt receptor cfz-2 to regulate QR neuroblast descendant migration, and to direct ALM migration (PubMed:16109397). Also plays a role in axon growth and guidance in HSN and male CP neurons (PubMed:16109397). In addition, together with wnt ligand cwn-1, negatively regulates developmental neurite pruning of AIM neurons probably by acting as a ligand for receptor tyrosine kinase cam-1 (PubMed:19561603). Through the cam-1 receptor also probably regulates the outgrowth of neurites from RME GABAergic motor neurons (PubMed:20711352). May act redundantly with other Wnt ligands such as cwn-1 and mom-2 to control seam cell polarity (PubMed:22022276).