Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative killer cell immunoglobulin-like receptor like protein KIR3DP1 (KIR3DP1) Recombinant Protein | KIR3DP1 recombinant protein

Recombinant Human Putative killer cell immunoglobulin-like receptor like protein KIR3DP1 (KIR3DP1)

Gene Names
KIR3DP1; KIRX; KIR48; CD158c; KIR2DS6; KIR3DS2P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative killer cell immunoglobulin-like receptor like protein KIR3DP1 (KIR3DP1); Recombinant Human Putative killer cell immunoglobulin-like receptor like protein KIR3DP1 (KIR3DP1); KIR3DP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-328, Full length protein
Sequence
HEGGQDKPFLSAWPSPVVSEGEHVALQCRSRLGFNEFSLSKEDGMPVPELYNRVFRNTVFIGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGKFNDTLRLTGELHDGVSKANFSIGRMTQDLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLCGKPSLSAQPRPMVKAGESVTLSCSSRSSYDIYHLSREGEAHELRFPAVPKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSDLSDPLLVSVTDSMKEKGKDVIL
Sequence Length
307
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,055 Da
NCBI Official Full Name
Putative killer cell immunoglobulin-like receptor like protein KIR3DP1
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, three Ig domains pseudogene 1
NCBI Official Symbol
KIR3DP1
NCBI Official Synonym Symbols
KIRX; KIR48; CD158c; KIR2DS6; KIR3DS2P
UniProt Protein Name
Putative killer cell immunoglobulin-like receptor like protein KIR3DP1
UniProt Gene Name
KIR3DP1
UniProt Synonym Gene Names
CD158C; KIR2DS6; KIR48; KIRX

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. This gene is considered to be a pseudogene based on the absence of transcription and it lacks several functional domains compared to other killer cell immunoglobulin-like receptors. A rare haplotype, the result of a recombinantion event, has two copies of this gene, one of which may encode a secreted protein. (PMID: 15580659)[provided by RefSeq, Mar 2011]

Uniprot Description

MiscellaneousPubMed:15580659, identified a chromosomal rearrangement producing a recombinant gene composed of the promoter and first exon of KIR2DL5A fused to KIR3DP1 which was originally thought to be a pseudogene. This leads to the expression in 4.5 percent of a Spanish Caucasoid population of an mRNA which may encode a chimeric protein KIR2DL5A/KIR3DP1.

Research Articles on KIR3DP1

Similar Products

Product Notes

The KIR3DP1 kir3dp1 (Catalog #AAA1057235) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-328, Full length protein. The amino acid sequence is listed below: HEGGQDKPFL SAWPSPVVSE GEHVALQCRS RLGFNEFSLS KEDGMPVPEL YNRVFRNTVF IGPVTPAHAG TYRCRGSHPH FLTGWSAPSN PLVIMVTGVH RKPSLLAHPG PLVKSEETVI LQCWSDVMFE HFLLHREGKF NDTLRLTGEL HDGVSKANFS IGRMTQDLAG TYRCYGSVPH SPYQLSAPSD PLDIVITGLC GKPSLSAQPR PMVKAGESVT LSCSSRSSYD IYHLSREGEA HELRFPAVPK VNGTFQANFP LGPATHGGTY RCFGSFRDSP YEWSDLSDPL LVSVTDSMKE KGKDVIL. It is sometimes possible for the material contained within the vial of "Putative killer cell immunoglobulin-like receptor like protein KIR3DP1 (KIR3DP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.