Opsin Rh6 (Rh6) Recombinant Protein | Rh6 recombinant protein
Recombinant Drosophila melanogaster Opsin Rh6 (Rh6)
Gene Names
Rh6; CG5192; Dm Rh6; DMELRH6; DmelCG5192; R8; Rh; rh6; RH6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Opsin Rh6 (Rh6); Recombinant Drosophila melanogaster Opsin Rh6 (Rh6); Recombinant Opsin Rh6 (Rh6); Opsin Rh6; Rhodopsin Rh6; long-wavelength; Rh6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-369
Sequence
MASLHPPSFAYMRDGRNLSLAESVPAEIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESMHLSPLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGKDDLTSDSRTQATAEISESQA
Sequence Length
369
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,691 Da
NCBI Official Full Name
rhodopsin 6, partial
NCBI Official Synonym Full Names
Rhodopsin 6
NCBI Official Symbol
Rh6
NCBI Official Synonym Symbols
CG5192; Dm Rh6; DMELRH6; DmelCG5192; R8; Rh; rh6; RH6
NCBI Protein Information
CG5192 gene product from transcript CG5192-RB; CG5192-PB; R8 rhodopsin; Rh6-PB; rhodopsin 6; rhodopsin-6
UniProt Protein Name
Opsin Rh6
Protein Family
UniProt Gene Name
Rh6
UniProt Entry Name
OPS6_DROME
Uniprot Description
Function: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular location: Membrane; Multi-pass membrane protein.
Tissue specificity: Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells. Rh6 is expressed in a subset of R8 cells, most likely expressed in the subset of R8 cells paired with Rh4-expressing R7 cells (R7y).
Post-translational modification: Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region
By similarity.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Research Articles on Rh6
Similar Products
Product Notes
The Rh6 rh6 (Catalog #AAA1054439) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-369. The amino acid sequence is listed below: MASLHPPSFA YMRDGRNLSL AESVPAEIMH MVDPYWYQWP PLEPMWFGII GFVIAILGTM SLAGNFIVMY IFTSSKGLRT PSNMFVVNLA FSDFMMMFTM FPPVVLNGFY GTWIMGPFLC ELYGMFGSLF GCVSIWSMTL IAYDRYCVIV KGMARKPLTA TAAVLRLMVV WTICGAWALM PLFGWNRYVP EGNMTACGTD YFAKDWWNRS YIIVYSLWVY LTPLLTIIFS YWHIMKAVAA HEKAMREQAK KMNVASLRNS EADKSKAIEI KLAKVALTTI SLWFFAWTPY TIINYAGIFE SMHLSPLSTI CGSVFAKANA VCNPIVYGLS HPKYKQVLRE KMPCLACGKD DLTSDSRTQA TAEISESQA. It is sometimes possible for the material contained within the vial of "Opsin Rh6 (Rh6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
