Probable cobalamin biosynthesis protein CobD (cobD) Recombinant Protein | cobD recombinant protein
Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable cobalamin biosynthesis protein CobD (cobD); Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD); cobD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-306
Sequence
MINPIYLILADFFDRYIGEPPEKVHPVIFIGKLIIFFENVFKSTNSINKSRDLLFGFFNVILVLAIVFFMAYEIEQVINSISNSYIRISLYSIILSFSIGHKSLIEFSKAPIRYIVNNDIDGAKKSVQCVVSRNTSELGKKHILSASIESASENITDSIIAPLIYVAIFGLPGAFLYRAVNTFDAMIGYKSEKYLYYGKTAAYLDDILNFIPSRIAGMLLIITAPFYGGKIKSAFYGFFKEGNKTPSPNSGYTMATIANSLNMGLEKIGCYKLGKGEITIEKALNSLKAVDYSVLLFLIIYTVLLM
Sequence Length
306
Species
Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for cobD recombinant protein
cobD
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,173 Da
NCBI Official Full Name
cobalamin biosynthesis protein
NCBI Official Symbol
cobD
NCBI Protein Information
cobalamin biosynthesis protein
UniProt Protein Name
Probable cobalamin biosynthesis protein CobD
Protein Family
UniProt Gene Name
cobD
UniProt Entry Name
COBD_METM5
Uniprot Description
Function: Converts cobyric acid to cobinamide by the addition of aminopropanol on the F carboxylic group
By similarity. HAMAP-Rule MF_00024
Pathway: Cofactor biosynthesis; adenosylcobalamin biosynthesis. HAMAP-Rule MF_00024
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential HAMAP-Rule MF_00024.
Sequence similarities: Belongs to the CobD/CbiB family.
Similar Products
Product Notes
The cobD cobd (Catalog #AAA1039497) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-306. The amino acid sequence is listed below: MINPIYLILA DFFDRYIGEP PEKVHPVIFI GKLIIFFENV FKSTNSINKS RDLLFGFFNV ILVLAIVFFM AYEIEQVINS ISNSYIRISL YSIILSFSIG HKSLIEFSKA PIRYIVNNDI DGAKKSVQCV VSRNTSELGK KHILSASIES ASENITDSII APLIYVAIFG LPGAFLYRAV NTFDAMIGYK SEKYLYYGKT AAYLDDILNF IPSRIAGMLL IITAPFYGGK IKSAFYGFFK EGNKTPSPNS GYTMATIANS LNMGLEKIGC YKLGKGEITI EKALNSLKAV DYSVLLFLII YTVLLM. It is sometimes possible for the material contained within the vial of "Probable cobalamin biosynthesis protein CobD (cobD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
