Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) Recombinant Protein | arnF recombinant protein

Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

• Gene Names: arnF; ECK2252; JW5373; pbgE3; pmrM; yfbJ
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Recombinant Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-am; arnF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-128
• Sequence: MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY
• Sequence Length: 128

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 90111409
• NCBI GeneID: 945344
• NCBI Accession #: NP_416761.4
• NCBI GenBank Nucleotide #: NC_000913.2
• UniProt Accession #: P76474; Q2MAN0; Q47376
• Molecular Weight: 14,085 Da
• NCBI Official Full Name: undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
• NCBI Official Symbol: arnF
• NCBI Official Synonym Symbols: ECK2252; JW5373; pbgE3; pmrM; yfbJ
• NCBI Protein Information: undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
• UniProt Protein Name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
• Protein Family: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase
• UniProt Gene Name: arnF
• UniProt Synonym Gene Names: pmrM; yfbJ; L-Ara4N-phosphoundecaprenol flippase subunit ArnF
• UniProt Entry Name: ARNF_ECOLI

NCBI Description

Involved in the modification of lipid A phosphates with aminoarabinose that is required for polymyxin B and cationic antimicrobial peptide resistance. [More information is available at EcoGene: EG14094]. ArnF is an integral membrane component of the ArnE/ArnF undecaprenyl-phosphate--L-Ara4N flippase. [More information is available at EcoCyc: G7171].

Uniprot Description

Function: Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane. Ref.6

Pathway: Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis. HAMAP-Rule MF_00538

Subunit structure: Heterodimer of ArnE and ArnF

Probable. Ref.6

Subcellular location: Cell inner membrane; Multi-pass membrane protein HAMAP-Rule MF_00538.

Induction: Induced by BasR. Ref.5

Disruption phenotype: Cells lacking this gene are polymyxin sensitive. Lipid A is no longer modified with L-Ara4N even though the level of the lipid-linked donor of the L-Ara4N moiety, alpha-L-Ara4N-phosphoundecaprenol, is not reduced. However, the alpha-L-Ara4N-phosphoundecaprenol is less concentrated on the periplasmic surface of the inner membrane when compared to wild type. Ref.6

Sequence similarities: Belongs to the ArnF family.

Sequence caution: The sequence AAB04894.1 differs from that shown. Reason: Frameshift at position 128.