Peroxidase 25 (PER25) Recombinant Protein | PER25 recombinant protein
Recombinant Arabidopsis thaliana Peroxidase 25 (PER25)
Gene Names
AT2G41480; AtPRX25; peroxidase 25; PRX25; T26J13.7; T26J13_7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxidase 25 (PER25); Recombinant Arabidopsis thaliana Peroxidase 25 (PER25); PER25 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-328, Full length protein
Sequence
QLLKNGYYSTSCPKAESIVRSTVESHFDSDPTISPGLLRLHFHDCFVQGCDGSVLIKGKSAEQAALPNLGLRGLEVIDDAKARLEAVCPGVVSCADILALAARDSVDLSDGPSWRVPTGRKDGRISLATEASNLPSPLDSVAVQKQKFQDKGLDTHDLVTLLGAHTIGQTDCLFFRYRLYNFTVTGNSDPTISPSFLTQLKTLCPPNGDGSKRVALDIGSPSKFDESFFKNLRDGNAILESDQRLWSDAETNAVVKKYASRLRGLLGFRFDYEFGKAMIKMSSIDVKTDVDGEVRKVCSKVN
Sequence Length
302
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,886 Da
NCBI Official Full Name
peroxidase superfamily protein
NCBI Official Symbol
AT2G41480
NCBI Official Synonym Symbols
AtPRX25; peroxidase 25; PRX25; T26J13.7; T26J13_7
NCBI Protein Information
peroxidase superfamily protein
UniProt Protein Name
Peroxidase 25
Protein Family
UniProt Gene Name
PER25
UniProt Synonym Gene Names
P25; Atperox P25
NCBI Description
Encodes a cationic cell-wall-bound peroxidase homolog that is involved in the lignification of cell walls.
Uniprot Description
Removal of H2O2, oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.
Research Articles on PER25
Similar Products
Product Notes
The PER25 per25 (Catalog #AAA1037210) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-328, Full length protein. The amino acid sequence is listed below: QLLKNGYYST SCPKAESIVR STVESHFDSD PTISPGLLRL HFHDCFVQGC DGSVLIKGKS AEQAALPNLG LRGLEVIDDA KARLEAVCPG VVSCADILAL AARDSVDLSD GPSWRVPTGR KDGRISLATE ASNLPSPLDS VAVQKQKFQD KGLDTHDLVT LLGAHTIGQT DCLFFRYRLY NFTVTGNSDP TISPSFLTQL KTLCPPNGDG SKRVALDIGS PSKFDESFFK NLRDGNAILE SDQRLWSDAE TNAVVKKYAS RLRGLLGFRF DYEFGKAMIK MSSIDVKTDV DGEVRKVCSK VN. It is sometimes possible for the material contained within the vial of "Peroxidase 25 (PER25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
