Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Modulator of FtsH protease YccA (yccA) Recombinant Protein | yccA recombinant protein

Recombinant Escherichia coli Modulator of FtsH protease YccA (yccA)

Gene Names
yccA; ECK0961; JW0953
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Modulator of FtsH protease YccA (yccA); Recombinant Escherichia coli Modulator of FtsH protease YccA (yccA); Recombinant Modulator of FtsH protease YccA (yccA); Modulator of FtsH protease YccA; yccA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-219
Sequence
MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFETSNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
Sequence Length
219
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,363 Da
NCBI Official Full Name
HflBKC-binding inner membrane protein, UPF0005 family
NCBI Official Symbol
yccA
NCBI Official Synonym Symbols
ECK0961; JW0953
NCBI Protein Information
HflBKC-binding inner membrane protein, UPF0005 family
UniProt Protein Name
Modulator of FtsH protease YccA
UniProt Gene Name
yccA
UniProt Entry Name
YCCA_ECOLI

NCBI Description

YccA is a substrate or modulator of FtsH-mediated proteolysis. [More information is available at EcoCyc: EG11113].

Uniprot Description

Function: Negatively modulates the activity of the FtsH protease for membrane substrates. Overexpression or stabilizing YccA counteracts the FtsH-mediated degradation of SecY when the SecYEG preprotein translocator is jammed. Ref.8

Subunit structure: Both wild-type and the yccA11 mutant interact with the FtsH/HflKC complex.

Subcellular location: Cell inner membrane; Multi-pass membrane protein. Note: There are conflicting results regarding the localization of the C-terminus of this protein; Ref.6 gives the C-terminus in the periplasm while Ref.7 gives the C-terminus in the cytoplasm. We show the periplasmic location.

Induction: Regulated in a Cpx-dependent fashion. Ref.8

Post-translational modification: YccA is processively degraded by FtsH; degradation initiates via the approximately 20 residue N-terminal tail in a sequence non-specific manner. The deletion mutant yccA11 is resistant to FtsH-mediated degradation, probably because it is too short to be degraded by FtsH.

Disruption phenotype: No effect on SecY degradation. Ref.5

Sequence similarities: Belongs to the BI1 family.

Research Articles on yccA

Similar Products

Product Notes

The yccA ycca (Catalog #AAA1027616) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-219. The amino acid sequence is listed below: MDRIVSSSHD RTSLLSTHKV LRNTYFLLSL TLAFSAITAT ASTVLMLPSP GLILTLVGMY GLMFLTYKTA NKPTGIISAF AFTGFLGYIL GPILNTYLSA GMGDVIAMAL GGTALVFFCC SAYVLTTRKD MSFLGGMLMA GIVVVLIGMV ANIFLQLPAL HLAISAVFIL ISSGAILFET SNIIHGGETN YIRATVSLYV SLYNIFVSLL SILGFASRD. It is sometimes possible for the material contained within the vial of "Modulator of FtsH protease YccA (yccA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.