RNA polymerase sigma-54 factor (sigL) Recombinant Protein | sigL recombinant protein
Recombinant Bacillus subtilis RNA polymerase sigma-54 factor (sigL)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RNA polymerase sigma-54 factor (sigL); Recombinant Bacillus subtilis RNA polymerase sigma-54 factor (sigL); sigL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-436, Full length protein
Sequence
MDMKLQQVQVLKPQLTQELRQAITLLGYHSAELAEYIDELSLENPLIERKETDTPPLSYHKTNKNRMNAQEAGLQLSNPQKTLQDALKQQSLDMNLTNTEKKIFNYLIHSLDSNGYLEEDIEEAARRLSVSAKEAEAVLAKLQSLEPAGIGARSLQECILLQLQRLPNRNEQAEMLVSAHFDAFAQKKWKTLSVETGIPLHTIQDISDDIAALHPRPGLLFARPEQDVYIEPDIFITVKNGHIAAELNTRSFPEIDLHPQYRTLLSSGSCQDTVSYLSAKYQEWRWLSRALRQRKQTITRIINELITRQKDFFLKGRSAMKPLTLREVADCLSLHESTVSRAIKGKTIQTPYGLFEMKLFFSAKAEASGDGDASNYAVKTHLENLINQEDKTKPLSDQKLVDLLYEQHGIQISRRTVAKYRDQMNIPSSAARKRYK
Sequence Length
436
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,701 Da
NCBI Official Full Name
RNA polymerase sigma-54 factor
NCBI Official Symbol
sigL
NCBI Protein Information
RNA polymerase sigma-54 factor
UniProt Protein Name
RNA polymerase sigma-54 factor
Protein Family
UniProt Gene Name
sigL
Uniprot Description
Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of the levanase operon. The open complex (sigma-54 and core RNA polymerase) serves as the receptor for receipt of the melting signal from the remotely bound activator protein LevR for the expression of the levanase operon.
Research Articles on sigL
Similar Products
Product Notes
The sigL sigl (Catalog #AAA1024516) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-436, Full length protein. The amino acid sequence is listed below: MDMKLQQVQV LKPQLTQELR QAITLLGYHS AELAEYIDEL SLENPLIERK ETDTPPLSYH KTNKNRMNAQ EAGLQLSNPQ KTLQDALKQQ SLDMNLTNTE KKIFNYLIHS LDSNGYLEED IEEAARRLSV SAKEAEAVLA KLQSLEPAGI GARSLQECIL LQLQRLPNRN EQAEMLVSAH FDAFAQKKWK TLSVETGIPL HTIQDISDDI AALHPRPGLL FARPEQDVYI EPDIFITVKN GHIAAELNTR SFPEIDLHPQ YRTLLSSGSC QDTVSYLSAK YQEWRWLSRA LRQRKQTITR IINELITRQK DFFLKGRSAM KPLTLREVAD CLSLHESTVS RAIKGKTIQT PYGLFEMKLF FSAKAEASGD GDASNYAVKT HLENLINQED KTKPLSDQKL VDLLYEQHGI QISRRTVAKY RDQMNIPSSA ARKRYK. It is sometimes possible for the material contained within the vial of "RNA polymerase sigma-54 factor (sigL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
