L-amino-acid oxidase Recombinant Protein | LAAO recombinant protein
Recombinant Crotalus atrox L-amino-acid oxidase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-amino-acid oxidase; Recombinant Crotalus atrox L-amino-acid oxidase; LAAO recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-516, Full length protein
Sequence
AHDRNPLEECFRETDYEEFLEIAKNGLTATSNPKRVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERVGGRVRTYRKKDWYANLGPMRLPTKHRIVREYIKKFDLKLNEFSQENENAWYFIKNIRKRVREVKNNPGLLEYPVKPSEEGKSAAQLYVESLRKVVKELKRTNCKYILDKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFGYEKRFDEIVGGMDQLPTSMYEAIKEKVQVHFNARVIEIQQNDREATVTYQTSANEMSSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCKKKFWEDDGIRGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPKEDIQTFCRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPFKRIYFAGEYTAQFHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEF
Sequence Length
498
Species
Crotalus atrox (Western diamondback rattlesnake)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
58,767 Da
NCBI Official Full Name
L-amino-acid oxidase
UniProt Protein Name
L-amino-acid oxidase
Protein Family
UniProt Gene Name
LAAO
UniProt Synonym Gene Names
LAO
Uniprot Description
Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (L-Leu), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (). In addition, this protein induces hemorrhage and apoptosis.
Similar Products
Product Notes
The L-amino-acid oxidase laao (Catalog #AAA1017163) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-516, Full length protein. The amino acid sequence is listed below: AHDRNPLEEC FRETDYEEFL EIAKNGLTAT SNPKRVVIVG AGMAGLSAAY VLAGAGHQVT VLEASERVGG RVRTYRKKDW YANLGPMRLP TKHRIVREYI KKFDLKLNEF SQENENAWYF IKNIRKRVRE VKNNPGLLEY PVKPSEEGKS AAQLYVESLR KVVKELKRTN CKYILDKYDT YSTKEYLLKE GNLSPGAVDM IGDLLNEDSG YYVSFIESLK HDDIFGYEKR FDEIVGGMDQ LPTSMYEAIK EKVQVHFNAR VIEIQQNDRE ATVTYQTSAN EMSSVTADYV IVCTTSRAAR RIKFEPPLPP KKAHALRSVH YRSGTKIFLT CKKKFWEDDG IRGGKSTTDL PSRFIYYPNH NFTSGVGVII AYGIGDDANF FQALDFKDCA DIVINDLSLI HQLPKEDIQT FCRPSMIQRW SLDKYAMGGI TTFTPYQFQH FSEALTAPFK RIYFAGEYTA QFHGWIDSTI KSGLTAARDV NRASENPSGI HLSNDNEF. It is sometimes possible for the material contained within the vial of "L-amino-acid oxidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
