Phosphatidate cytidylyltransferase, photoreceptor-specific (CdsA) Recombinant Protein | CdsA recombinant protein
Recombinant Drosophila melanogaster Phosphatidate cytidylyltransferase, photoreceptor-specific (CdsA)
Gene Names
CdsA; cds; CDS; cdsA; CG7962; DmelCG7962; eye-cds; eye-CDS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidate cytidylyltransferase; photoreceptor-specific (CdsA); Recombinant Drosophila melanogaster Phosphatidate cytidylyltransferase; Recombinant Phosphatidate cytidylyltransferase; photoreceptor-specific EC= 2.7.7.41; CDP-DAG synthase CDP-DG synthase CDP-diacylglycerol synthase; CDS CDP-diglyceride pyrophosphorylase CDP; CdsA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-447
Sequence
MAEVRRRKGEDEPLEDTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELAKNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNLGDMLT
Sequence Length
447
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,511 Da
NCBI Official Full Name
CDP diglyceride synthetase
NCBI Official Synonym Full Names
CDP diglyceride synthetase
NCBI Official Symbol
CdsA
NCBI Official Synonym Symbols
cds; CDS; cdsA; CG7962; DmelCG7962; eye-cds; eye-CDS
NCBI Protein Information
CG7962 gene product from transcript CG7962-RA; CDP diglyceride synthetase; CDP-DAG synthase; CDP-diacylglycerol synthase; CDP-diacylglycerol synthetase; CDS-diacylglycerol synthase; CG7962-PA; CdsA-PA; cytidine diphosphate (CDP)-DAG synthase; winded
UniProt Protein Name
Phosphatidate cytidylyltransferase, photoreceptor-specific
Protein Family
UniProt Gene Name
CdsA
UniProt Synonym Gene Names
CDS
UniProt Entry Name
CDSA_DROME
Uniprot Description
Function: Required for the regeneration of the signaling molecule phosphatidylinositol 4,5-bisphosphate (PtdInsP2) from phosphatidic acid and maintenance of its steady supply during signaling thus plays an essential role during phospholipase C-mediated transduction.
Catalytic activity: CTP + phosphatidate = diphosphate + CDP-diacylglycerol.
Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Tissue specificity: Retina. Localized to the photoreceptor neurons, both in the compound eyes and ocelli.
Sequence similarities: Belongs to the CDS family.
Similar Products
Product Notes
The CdsA cdsa (Catalog #AAA1016696) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-447. The amino acid sequence is listed below: MAEVRRRKGE DEPLEDTAIS GSDAANKRNS AADSSDHVDS EEEKIPEEKF VDELAKNLPQ GTDKTPEILD SALKDLPDRW KNWVIRGIFT WIMICGFALI IYGGPLALMI TTLLVQVKCF QEIISIGYQV YRIHGLPWFR SLSWYFLLTS NYFFYGENLV DYFGVVINRV EYLKFLVTYH RFLSFALYII GFVWFVLSLV KKYYIKQFSL FAWTHVSLLI VVTQSYLIIQ NIFEGLIWFI VPVSMIVCND VMAYVFGFFF GRTPLIKLSP KKTWEGFIGG GFATVLFGIL FSYVLCNYQY FICPIQYSEE QGRMTMSCVP SYLFTPQEYS LKLFGIGKTL NLYPFIWHSI SLSLFSSIIG PFGGFFASGF KRAFKIKDFG DMIPGHGGIM DRFDCQFLMA TFVNVYISSF IRTPSPAKLL TQIYNLKPDQ QYQIYQSLKD NLGDMLT. It is sometimes possible for the material contained within the vial of "Phosphatidate cytidylyltransferase, photoreceptor-specific (CdsA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
