Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sperm-associated antigen 4 protein (Spag4) Recombinant Protein | Spag4 recombinant protein

Recombinant Rat Sperm-associated antigen 4 protein (Spag4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm-associated antigen 4 protein (Spag4); Recombinant Rat Sperm-associated antigen 4 protein (Spag4); Recombinant Sperm-associated antigen 4 protein (Spag4); Sperm-associated antigen 4 protein; Outer dense fiber-associated protein SPAG4 SUN domain-containing protein 4; Spag4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-444
Sequence
MRRNPRPGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPELGEPDGRMARGSSCGEPALSSGVPGGDTWAGSSRPKLAPRSHNGQTACGAATVRGGASEPSGSPAVLEEQLNLLPILDLRQEMPPPPVSKSFLSLFFQVLSVFLSLVADGLVCVYREICSIRFLFTAVSLLSIFLAALWWGLLYLIPPLENEPKEMLTLSQYHHRVHSQGQQLQQLQAELSKLHKEVTSVRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDRNTAYFWNRLSFWNYARPPSVILEPDVFPGNCWAFEGEQGQVVIRLPGHVQLSDITLQHPPPTVAHTGGASSAPRDFAVFGLQADDDETEVFLGKFIFEVQKSEIQTFHLQNDPPSAFPKVKIQILSNWGHPRFTCLYRVRAHGVRISESAEDNAMGVTGGPH
Sequence Length
444
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,693 Da
NCBI Official Full Name
sperm-associated antigen 4 protein
NCBI Official Synonym Full Names
sperm associated antigen 4
NCBI Official Symbol
Spag4
NCBI Protein Information
sperm-associated antigen 4 protein; sperm antigen 4; SUN domain-containing protein 4; outer dense fiber-associated protein SPAG4
UniProt Protein Name
Sperm-associated antigen 4 protein
UniProt Gene Name
Spag4
UniProt Synonym Gene Names
Sun4
UniProt Entry Name
SPAG4_RAT

NCBI Description

spermatid-specific structural protein; interacts with an outer dense fiber (Odf1) localized to the sperm tail via a leucine zipper motif [RGD, Feb 2006]

Uniprot Description

SPAG4: May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail

Protein type: Microtubule-binding; Cancer Testis Antigen (CTA); Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: microtubule; cytoplasm; integral to membrane; nuclear envelope

Molecular Function: identical protein binding; protein binding

Biological Process: nuclear membrane organization and biogenesis

Similar Products

Product Notes

The Spag4 spag4 (Catalog #AAA1016394) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-444. The amino acid sequence is listed below: MRRNPRPGSA ASSHNHTPNF YSENSNSSHS ATSGDSNGRR SAGPELGEPD GRMARGSSCG EPALSSGVPG GDTWAGSSRP KLAPRSHNGQ TACGAATVRG GASEPSGSPA VLEEQLNLLP ILDLRQEMPP PPVSKSFLSL FFQVLSVFLS LVADGLVCVY REICSIRFLF TAVSLLSIFL AALWWGLLYL IPPLENEPKE MLTLSQYHHR VHSQGQQLQQ LQAELSKLHK EVTSVRAAHS ERVAKLVFQR LNEDFVRKPD YALSSVGASI DLEKTSSDYE DRNTAYFWNR LSFWNYARPP SVILEPDVFP GNCWAFEGEQ GQVVIRLPGH VQLSDITLQH PPPTVAHTGG ASSAPRDFAV FGLQADDDET EVFLGKFIFE VQKSEIQTFH LQNDPPSAFP KVKIQILSNW GHPRFTCLYR VRAHGVRISE SAEDNAMGVT GGPH. It is sometimes possible for the material contained within the vial of "Sperm-associated antigen 4 protein (Spag4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.