Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B) Recombinant Protein | FCGR3B recombinant protein

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)

Gene Names
FCGR3B; CD16; FCG3; CD16A; CD16b; FCGR3; FCGR3A; FCR-10; FCRIII; FCRIIIb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B); Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B); FCGR3B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-200, Full length protein
Sequence
GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Sequence Length
184
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,216 Da
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor III-B isoform 2
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIIb
NCBI Official Symbol
FCGR3B
NCBI Official Synonym Symbols
CD16; FCG3; CD16A; CD16b; FCGR3; FCGR3A; FCR-10; FCRIII; FCRIIIb
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor III-B
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor III-B
UniProt Gene Name
FCGR3B
UniProt Synonym Gene Names
CD16B; FCG3; FCGR3; IGFR3; Fc-gamma RIII; Fc-gamma RIIIb; FcRIII; FcRIIIb

NCBI Description

The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1. [provided by RefSeq, Aug 2012]

Uniprot Description

Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.

Research Articles on FCGR3B

Similar Products

Product Notes

The FCGR3B fcgr3b (Catalog #AAA1015045) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-200, Full length protein. The amino acid sequence is listed below: GMRTEDLPKA VVFLEPQWYS VLEKDSVTLK CQGAYSPEDN STQWFHNESL ISSQASSYFI DAATVNDSGE YRCQTNLSTL SDPVQLEVHI GWLLLQAPRW VFKEEDPIHL RCHSWKNTAL HKVTYLQNGK DRKYFHHNSD FHIPKATLKD SGSYFCRGLV GSKNVSSETV NITITQGLAV STIS. It is sometimes possible for the material contained within the vial of "Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.