Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Amiloride-sensitive sodium channel subunit beta (Scnn1b) Recombinant Protein | Scnn1b recombinant protein

Recombinant Rat Amiloride-sensitive sodium channel subunit beta (Scnn1b), partial

Gene Names
Scnn1b; RNENACB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Amiloride-sensitive sodium channel subunit beta (Scnn1b); Recombinant Rat Amiloride-sensitive sodium channel subunit beta (Scnn1b); partial; Scnn1b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
76-512
Sequence
SWEVSVSLSMGFKTMNFPAVTVCNSSPFQYSKVKHLLKDLYKLMEAVLDKILAPKSSHTNTTSTLNFTIWNHTPLVLIDERNPDHPVVLNLFGDSHNSSNPAPGSTCNAQGCKVAMRLCSANGTVCTFRNFTSATQAVTEWYILQATNIFSQVLPQDLVGMGYAPDRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLLDKLQGKGEPYSPCTMNGSDVAIQNLYSDYNTTYSIQACLHSCFQDHMIHNCSCGHYLYPLPAGEKYCNNRDFPDWAYCYLSLQMSVVQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESPANN
Sequence Length
638
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,995 Da
NCBI Official Full Name
amiloride-sensitive sodium channel subunit beta
NCBI Official Synonym Full Names
sodium channel epithelial 1 beta subunit
NCBI Official Symbol
Scnn1b
NCBI Official Synonym Symbols
RNENACB
NCBI Protein Information
amiloride-sensitive sodium channel subunit beta
UniProt Protein Name
Amiloride-sensitive sodium channel subunit beta
UniProt Gene Name
Scnn1b
UniProt Synonym Gene Names
Beta-ENaC

NCBI Description

acts as an epithelial sodium ion channel; regulates salt and fluid transport in the kidney [RGD, Feb 2006]

Uniprot Description

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Research Articles on Scnn1b

Similar Products

Product Notes

The Scnn1b scnn1b (Catalog #AAA1010931) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 76-512. The amino acid sequence is listed below: SWEVSVSLSM GFKTMNFPAV TVCNSSPFQY SKVKHLLKDL YKLMEAVLDK ILAPKSSHTN TTSTLNFTIW NHTPLVLIDE RNPDHPVVLN LFGDSHNSSN PAPGSTCNAQ GCKVAMRLCS ANGTVCTFRN FTSATQAVTE WYILQATNIF SQVLPQDLVG MGYAPDRIIL ACLFGTEPCS HRNFTPIFYP DYGNCYIFNW GMTEKALPSA NPGTEFGLKL ILDIGQEDYV PFLASTAGAR LMLHEQRTYP FIREEGIYAM AGTETSIGVL LDKLQGKGEP YSPCTMNGSD VAIQNLYSDY NTTYSIQACL HSCFQDHMIH NCSCGHYLYP LPAGEKYCNN RDFPDWAYCY LSLQMSVVQR ETCLSMCKES CNDTQYKMTI SMADWPSEAS EDWILHVLSQ ERDQSSNITL SRKGIVKLNI YFQEFNYRTI EESPANN. It is sometimes possible for the material contained within the vial of "Amiloride-sensitive sodium channel subunit beta (Scnn1b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.