Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein cornichon homolog 3 (Cnih3) Recombinant Protein | Cnih3 recombinant protein

Recombinant Rat Protein cornichon homolog 3 (Cnih3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein cornichon homolog 3 (Cnih3); Recombinant Rat Protein cornichon homolog 3 (Cnih3); Recombinant Protein cornichon homolog 3 (Cnih3); Protein cornichon homolog 3; Cnih3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-160
Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCVMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Sequence Length
160
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,962 Da
NCBI Official Full Name
protein cornichon homolog 3
NCBI Official Synonym Full Names
cornichon homolog 3 (Drosophila)
NCBI Official Symbol
Cnih3
NCBI Protein Information
protein cornichon homolog 3; cornichon 3
UniProt Protein Name
Protein cornichon homolog 3
UniProt Gene Name
Cnih3
UniProt Entry Name
CNIH3_RAT

Uniprot Description

Function: Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization. Ref.1

Subunit structure: Acts as an auxiliary subunit for AMPA-selective glutamate receptors (AMPARs). Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH2, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Ref.1

Subcellular location: Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Note: Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells). Ref.1

Tissue specificity: Brain. Expressed in the neocortex, hippocampal formation, and cerebellum (at protein level). Ref.1

Sequence similarities: Belongs to the cornichon family.

Research Articles on Cnih3

Similar Products

Product Notes

The Cnih3 cnih3 (Catalog #AAA1010276) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-160. The amino acid sequence is listed below: MAFTFAAFCY MLSLVLCAAL IFFAIWHIIA FDELRTDFKS PIDQCNPVHA RERLRNIERI CFLLRKLVLP EYSIHSLFCV MFLCAQEWLT LGLNVPLLFY HFWRYFHCPA DSSELAYDPP VVMNADTLSY CQKEAWCKLA FYLLSFFYYL YCMIYTLVSS. It is sometimes possible for the material contained within the vial of "Protein cornichon homolog 3 (Cnih3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.