Uncharacterized outer membrane usher protein yraJ (yraJ) Recombinant Protein | yraJ recombinant protein
Recombinant Escherichia coli Uncharacterized outer membrane usher protein yraJ (yraJ)
Gene Names
yraJ; ECK3132; JW3113
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized outer membrane usher protein yraJ (yraJ); Recombinant Escherichia coli Uncharacterized outer membrane usher protein yraJ (yraJ); yraJ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
41-838, full length protein
Sequence
EEYYFDPIMLETTKSGMQTTDLSRFSKKYAQLPGTYQVDIWLNKKKVSQKKITFTANAEQLLQPQFTVEQLRELGIKVDEIPALAEKDDDSVINSLEQIIPGTAAEFDFNHQQLNLSIPQIALYRDARGYVSPSRWDDGIPTLFTNYSFTGSDNRYRQGNRSQRQYLNMQNGANFGPWRLRNYSTWTRNDQTSSWNTISSYLQRDIKALKSQLLLGESATSGSIFSSYTFTGVQLASDDNMLPNSQRGFAPTVRGIANSSAIVTIRQNGYVIYQSNVSAGAFEINDLYPSSNSGDLEVTIEESDGTQRRFIQPYSSLPMMQRPGHLKYSATAGRYRADANSDSKEPEFAEATAIYGLNNTFTLYGGLLGSEDYYALGIGIGGTLGALGALSMDINRADTQFDNQHSFHGYQWRTQYIKDIPETNTNIAVSYYRYTNDGYFSFNEANTRNWDYNSRQKSEIQFNISQTIFDGVSLYASGSQQDYWGNNDKNRNISVGVSGQQWGVGYSLNYQYSRYTDQNNDRALSLNLSIPLERWLPRSRVSYQMTSQKDRPTQHEMRLDGSLLDDGRLSYSLEQSLDDDNNHNSSLNASYRSPYGTFSAGYSYGNDSSQYNYGVTGGVVIHPHGVTLSQYLGNAFALIDANGASGVRIQNYPGIATDPFGYAVVPYLTTYQENRLSVDTTQLPDNVDLEQTTQFVVPNRGAMVAARFNANIGYRVLVTVSDRNGKPLPFGALASNDDTGQQSIVDEGGILYLSGISSKSQSWTVRWGNQADQQCQFAFSTPDSEPTTSVLQGTAQCH
Sequence Length
798
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
93,616 Da
NCBI Official Full Name
putative outer membrane protein
NCBI Official Symbol
yraJ
NCBI Official Synonym Symbols
ECK3132; JW3113
NCBI Protein Information
putative outer membrane protein
UniProt Protein Name
Outer membrane usher protein YraJ
Protein Family
UniProt Gene Name
yraJ
NCBI Description
FimD family.First 40 aa are predicted to be a type I signal peptide. [More information is available at EcoGene: EG12775].
Uniprot Description
Part of the yraHIJK fimbrial operon. Could contribute to adhesion to various surfaces in specific environmental niches. Increases adhesion to eukaryotic T24 bladder epithelial cells in the absence of fim operon. Probably involved in the export and assembly of fimbrial subunits across the outer membrane.
Similar Products
Product Notes
The yraJ yraj (Catalog #AAA1005423) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 41-838, full length protein. The amino acid sequence is listed below: EEYYFDPIML ETTKSGMQTT DLSRFSKKYA QLPGTYQVDI WLNKKKVSQK KITFTANAEQ LLQPQFTVEQ LRELGIKVDE IPALAEKDDD SVINSLEQII PGTAAEFDFN HQQLNLSIPQ IALYRDARGY VSPSRWDDGI PTLFTNYSFT GSDNRYRQGN RSQRQYLNMQ NGANFGPWRL RNYSTWTRND QTSSWNTISS YLQRDIKALK SQLLLGESAT SGSIFSSYTF TGVQLASDDN MLPNSQRGFA PTVRGIANSS AIVTIRQNGY VIYQSNVSAG AFEINDLYPS SNSGDLEVTI EESDGTQRRF IQPYSSLPMM QRPGHLKYSA TAGRYRADAN SDSKEPEFAE ATAIYGLNNT FTLYGGLLGS EDYYALGIGI GGTLGALGAL SMDINRADTQ FDNQHSFHGY QWRTQYIKDI PETNTNIAVS YYRYTNDGYF SFNEANTRNW DYNSRQKSEI QFNISQTIFD GVSLYASGSQ QDYWGNNDKN RNISVGVSGQ QWGVGYSLNY QYSRYTDQNN DRALSLNLSI PLERWLPRSR VSYQMTSQKD RPTQHEMRLD GSLLDDGRLS YSLEQSLDDD NNHNSSLNAS YRSPYGTFSA GYSYGNDSSQ YNYGVTGGVV IHPHGVTLSQ YLGNAFALID ANGASGVRIQ NYPGIATDPF GYAVVPYLTT YQENRLSVDT TQLPDNVDLE QTTQFVVPNR GAMVAARFNA NIGYRVLVTV SDRNGKPLPF GALASNDDTG QQSIVDEGGI LYLSGISSKS QSWTVRWGNQ ADQQCQFAFS TPDSEPTTSV LQGTAQCH. It is sometimes possible for the material contained within the vial of "Uncharacterized outer membrane usher protein yraJ (yraJ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
