Endoglucanase A (endA) Recombinant Protein | endA recombinant protein
Recombinant Fibrobacter succinogenes Endoglucanase A (endA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoglucanase A (endA); Recombinant Fibrobacter succinogenes Endoglucanase A (endA); endA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-453, Full length protein
Sequence
TDDYVEAAWMTTRFFGAQRSGQGPNWILDGTSNPTSFTKDSYNGKDVSGGWFDCGDHVMYGQSQGYASYVLALAYAEFTEVSTTFILVTTPTTRKPTTTPMKSGKPNKVRDLLEELRYEADFWVKAAIDGNNFVTVKGDGNADHQKWVTAGAMSKLGSGEGGEPRCITGNANDGFTSGLAAAMLAVMARVDPDTANQAKYLKAAKTAYSYAKSHKGVTNSQGFYESSWWDGRWEDGPFLAELELYRTTGENSYKTAAIDRYDNLKFSLGEGTHFMYSNVVPLSAVMAEAVFEETPHGMRKEAIGVLDLIYEEKAKDKIFQNPNGMGSGKFPVRVPSGGAFLYALSDKFNNTNEHMEMIEKNVSYLLGDNGSKKSYVVGFSKNGANAPSRPHHRGYYANEKRWRRSRRCSESSRKEQALGRYDCWRLY
Sequence Length
427
Species
Fibrobacter succinogenes (Bacteroides succinogenes)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
50,042 Da
NCBI Official Full Name
Endoglucanase A
UniProt Protein Name
Endoglucanase A
Protein Family
UniProt Gene Name
endA
Uniprot Description
High levels of endoglucanase activity detected on acid-swollen cellulose, ball-milled cellulose, and carboxymethyl cellulose; moderate levels detected on filter paper, phosphoric acid-swollen cellulose, lichenan, and xylan.
Similar Products
Product Notes
The endA enda (Catalog #AAA1004041) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-453, Full length protein. The amino acid sequence is listed below: TDDYVEAAWM TTRFFGAQRS GQGPNWILDG TSNPTSFTKD SYNGKDVSGG WFDCGDHVMY GQSQGYASYV LALAYAEFTE VSTTFILVTT PTTRKPTTTP MKSGKPNKVR DLLEELRYEA DFWVKAAIDG NNFVTVKGDG NADHQKWVTA GAMSKLGSGE GGEPRCITGN ANDGFTSGLA AAMLAVMARV DPDTANQAKY LKAAKTAYSY AKSHKGVTNS QGFYESSWWD GRWEDGPFLA ELELYRTTGE NSYKTAAIDR YDNLKFSLGE GTHFMYSNVV PLSAVMAEAV FEETPHGMRK EAIGVLDLIY EEKAKDKIFQ NPNGMGSGKF PVRVPSGGAF LYALSDKFNN TNEHMEMIEK NVSYLLGDNG SKKSYVVGFS KNGANAPSRP HHRGYYANEK RWRRSRRCSE SSRKEQALGR YDCWRLY. It is sometimes possible for the material contained within the vial of "Endoglucanase A (endA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
