Sporulation-delaying protein sdpB (sdpB) Recombinant Protein | sdpB recombinant protein
Recombinant Bacillus subtilis Sporulation-delaying protein sdpB (sdpB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sporulation-delaying protein sdpB (sdpB); Recombinant Bacillus subtilis Sporulation-delaying protein sdpB (sdpB); Recombinant Sporulation-delaying protein sdpB (sdpB); Sporulation-delaying protein sdpB; sdpB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-323
Sequence
MKILNSLEGYIDTYNPWKNTYALFRSLLGFSTLLVLLFNSTDILFSYSANNVTCENVYIPTAFCFAKEYSINFEIIRYLMIFILTLVVIGWRPRFTGLFHWYICYSIQTSALTIDGGEQIATVLSFLILPVTLLDSRRNHWNIKKNNNESFTKKTVLFYIMTIIKIQVFIIYLNAALERLKNKEWAEGTAIYYFFSDPVFGLPEYQLNLMNPLLESNFIVVITWLVTIFELFLAASIISNIRIKRIALVLGILFHIGIIFSIGIVSFGLIMISALIIYLHPVQQNITMNWCSPLFKYIYVKGKRNFKRIGGESVKFLTKLFHS
Sequence Length
323
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,450 Da
NCBI Official Full Name
exporter of killing factor SpbC
NCBI Official Symbol
sdpB
NCBI Protein Information
exporter of killing factor SpbC
UniProt Protein Name
Sporulation-delaying protein SdpB
Protein Family
UniProt Gene Name
sdpB
UniProt Synonym Gene Names
yvaX
UniProt Entry Name
SDPB_BACSU
Uniprot Description
Function: Required for the maturation of SdpC.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Induction: By Spo0A during nutrient starvation. Repressed by AbrB during regular growth when nutrients are plentiful, in association with the transcriptional repressor Abh.
Similar Products
Product Notes
The sdpB sdpb (Catalog #AAA1003901) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-323. The amino acid sequence is listed below: MKILNSLEGY IDTYNPWKNT YALFRSLLGF STLLVLLFNS TDILFSYSAN NVTCENVYIP TAFCFAKEYS INFEIIRYLM IFILTLVVIG WRPRFTGLFH WYICYSIQTS ALTIDGGEQI ATVLSFLILP VTLLDSRRNH WNIKKNNNES FTKKTVLFYI MTIIKIQVFI IYLNAALERL KNKEWAEGTA IYYFFSDPVF GLPEYQLNLM NPLLESNFIV VITWLVTIFE LFLAASIISN IRIKRIALVL GILFHIGIIF SIGIVSFGLI MISALIIYLH PVQQNITMNW CSPLFKYIYV KGKRNFKRIG GESVKFLTKL FHS. It is sometimes possible for the material contained within the vial of "Sporulation-delaying protein sdpB (sdpB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
