Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Electron transport complex protein RnfG (rnfG) Recombinant Protein | rnfG recombinant protein

Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG (rnfG)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Electron transport complex protein RnfG (rnfG); Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG (rnfG); rnfG recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-217
Sequence
MTDTPPPEKPKLPWFKASPLAHGIMLAMFALVTAVLLAVANDSTSAPIAARGAEDLAASLEQVIPHDLHDNDLAAAMRPVSDAEEGTIKVYVATKAGAVTGLAYELSGPGYSGQIRVLLGIAPDGTLLGVRVLSHTETPGLGDKIEVAKDDWILGFAGKSLADPEPGHWKVKRDGGVFDQFSGATITPRAVVKTIYRGLMFFDRNKAALTAPLPPKS
Sequence Length
217
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for rnfG recombinant protein
rnfG

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
22,847 Da
NCBI Official Full Name
Electron transport complex protein RnfG
UniProt Protein Name
Electron transport complex protein RnfG
UniProt Gene Name
rnfG
UniProt Entry Name
RNFG_RHOCA

Uniprot Description

Function: Required for nitrogen fixation. May be part of a membrane complex functioning as an intermediate in the electron transport to nitrogenase. HAMAP-Rule MF_00479

Subunit structure: Composed of at least six subunits; RnfA, RnfB, RnfC, RnfD, RnfE and RnfG.

Subcellular location: Cell inner membrane

Potential HAMAP-Rule MF_00479.

Induction: Expression is reduced under iron-limiting conditions. HAMAP-Rule MF_00479

Sequence similarities: Belongs to the RnfG family.

Sequence caution: The sequence CAA51397.1 differs from that shown. Reason: Frameshift at positions 22, 77, 101 and 213.

Similar Products

Product Notes

The Electron transport complex protein RnfG (rnfG) rnfg (Catalog #AAA1003247) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-217. The amino acid sequence is listed below: MTDTPPPEKP KLPWFKASPL AHGIMLAMFA LVTAVLLAVA NDSTSAPIAA RGAEDLAASL EQVIPHDLHD NDLAAAMRPV SDAEEGTIKV YVATKAGAVT GLAYELSGPG YSGQIRVLLG IAPDGTLLGV RVLSHTETPG LGDKIEVAKD DWILGFAGKS LADPEPGHWK VKRDGGVFDQ FSGATITPRA VVKTIYRGLM FFDRNKAALT APLPPKS. It is sometimes possible for the material contained within the vial of "Electron transport complex protein RnfG (rnfG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.