Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) Recombinant Protein | CD36_17300 recombinant protein
Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Altered inheritance of mitochondria protein 36; mitochondrial (AIM36); Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 36; Recombinant Altered inheritance of mitochondria protein 36; mitochondrial; Found in mitochondria protein 39; CD36_17300 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-293
Sequence
VRTPIFHQTPIQIIKRNYVIVHKERKKEPVIRYLFYMLVASWVAIYFVANRVDKKKPPKQSFTEREFQSYEEETGLKRRNKLISHHMNSKYKFYVIPYVHDEEELNRVANLLQHKDENATVKIIDPAQLIEEQKKDEGMKYHYLLEDLDEQGKPYPPGLITAVIKQEIYKILNTREGTFDTNFLIKNYPQTTNEAIKFENDISDIQKCLILHYDMLNELPKNKTDEEQRAIKNVDGYFSSVGKSKTLVEKFDPMDKEFEDIILEDI
Sequence Length
293
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,791 Da
NCBI Official Full Name
hypothetical mitochondrial protein, conserved
NCBI Official Symbol
CD36_17300
NCBI Protein Information
hypothetical mitochondrial protein, conserved
UniProt Protein Name
Altered inheritance of mitochondria protein 36, mitochondrial
UniProt Gene Name
AIM36
UniProt Synonym Gene Names
FMP39
UniProt Entry Name
AIM36_CANDC
Uniprot Description
Subcellular location: Mitochondrion membrane; Single-pass membrane protein
By similarity.
Sequence similarities: Belongs to the AIM36 family.
Similar Products
Product Notes
The CD36_17300 aim36 (Catalog #AAA1001524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-293. The amino acid sequence is listed below: VRTPIFHQTP IQIIKRNYVI VHKERKKEPV IRYLFYMLVA SWVAIYFVAN RVDKKKPPKQ SFTEREFQSY EEETGLKRRN KLISHHMNSK YKFYVIPYVH DEEELNRVAN LLQHKDENAT VKIIDPAQLI EEQKKDEGMK YHYLLEDLDE QGKPYPPGLI TAVIKQEIYK ILNTREGTFD TNFLIKNYPQ TTNEAIKFEN DISDIQKCLI LHYDMLNELP KNKTDEEQRA IKNVDGYFSS VGKSKTLVEK FDPMDKEFED IILEDI. It is sometimes possible for the material contained within the vial of "Altered inheritance of mitochondria protein 36, mitochondrial (AIM36), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
