Protein Vpx (vpx) Recombinant Protein | vpx recombinant protein

Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx)

Cat. Num. AAA1001333

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein Vpx (vpx); Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx); vpx recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-112, Full length protein
• Sequence: MTDPRERVPPGNSGEETIGEAFEWLDRTIEALNREAVNHLPRELIFQVWQRSWRYWHDDQGMSPSYTKYRYLCLMQKAVFIHFKRGCTCLGGGHGPGGWRSGPPPPPPPGLV
• Sequence Length: 112

• Species: Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) (HIV-2)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 139448
• UniProt Accession #: P18045
• Molecular Weight: 12,820 Da
• NCBI Official Full Name: Protein Vpx
• UniProt Protein Name: Protein Vpx
• Protein Family: Protein
• UniProt Gene Name: vpx

Uniprot Description

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription ().