Early protein GP6 (6) Recombinant Protein | 6 recombinant protein

Recombinant Bacillus phage phi29 Early protein GP6 (6)

Cat. Num. AAA1054314

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Early protein GP6 (6); Recombinant Bacillus phage phi29 Early protein GP6 (6); 6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-104, Full length protein
• Sequence: MAKMMQREITKTTVNVAKMVMVDGEVQVEQLPSETFVGNLTMEQAQWRMKRKYKGEPVQVVSVEPNTEVYELPVEKFLEVATVRVEKDEDQEEQTEAPEEQVAE
• Sequence Length: 104

• Species: Bacillus phage phi29 (Bacteriophage phi-29)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 194186879
• NCBI GeneID: 6446509
• NCBI Accession #: YP_002004534.1
• NCBI GenBank Nucleotide #: NC_011048.1
• UniProt Accession #: P03685; B3VMP1
• Molecular Weight: 12,005 Da
• NCBI Official Full Name: double-stranded DNA-binding protein p6
• NCBI Official Symbol: 6
• NCBI Protein Information: dsDNA binding protein
• UniProt Protein Name: Histone-like protein p6
• UniProt Gene Name: 6
• UniProt Synonym Gene Names: gp6Curated

Uniprot Description

Histone-like nucleoprotein that binds to the viral dsDNA and responsible for wrapping and compacting the viral DNA about 4-fold. Forms a nucleoprotein complex in which the DNA adopts a right-handed toroidal conformation winding around a protein core. Binds ito most, if not all, the viral genome, although with different affinity, the highest one corresponding to the genome ends. The formation of the nucleoprotein complex at the genome ends, activates the initiation of viral DNA replication. The binding of p6 would recruit the complex formed by the TP and the DNA polymerase to the origin. Protein p6 also represses early transcription from promoter C2, and, together with protein p4, represses transcription from promoters A2b and A2c and activates late transcription from promoter A3. Protein p6 is therefore involved in the early to late transcription switch. The formation of the nucleoprotein complex at the right end of the phage genome where the early promoter C2 is located affects local topology, which may contribute to the promoter repression.