RPII140-upstream gene protein (140up) Recombinant Protein | 140up recombinant protein
Recombinant Drosophila melanogaster RPII140-upstream gene protein (140up)
Gene Names
140up; CG9852; DmelCG9852; DmRP140-upstream; DmRP140up; l(3)88Ba; l(3)Z6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RPII140-upstream gene protein (140up); Recombinant Drosophila melanogaster RPII140-upstream gene protein (140up); Recombinant RPII140-upstream gene protein (140up); RPII140-upstream gene protein; 140up recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-261
Sequence
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLERLKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMENNQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMSVYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSLLLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEKTSEHVSLDTIK
Sequence Length
261
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,182 Da
NCBI Official Full Name
upstream of RpII140
NCBI Official Synonym Full Names
upstream of RpII140
NCBI Official Symbol
140up
NCBI Official Synonym Symbols
CG9852; DmelCG9852; DmRP140-upstream; DmRP140up; l(3)88Ba; l(3)Z6
NCBI Protein Information
CG9852 gene product from transcript CG9852-RA; 140up-PA; CG9852-PA; upstream of RpII140
UniProt Protein Name
RPII140-upstream gene protein
UniProt Gene Name
140up
UniProt Entry Name
140U_DROME
Uniprot Description
Function: Essential for viability. Ref.1
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Similar Products
Product Notes
The 140up 140up (Catalog #AAA1064801) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-261. The amino acid sequence is listed below: MNFLWKGRRF LIAGILPTFE GAADEIVDKE NKTYKAFLAS KPPEETGLER LKQMFTIDEF GSISSELNSV YQAGFLGFLI GAIYGGVTQS RVAYMNFMEN NQATAFKSHF DAKKKLQDQF TVNFAKGGFK WGWRVGLFTT SYFGIITCMS VYRGKSSIYE YLAAGSITGS LYKVSLGLRG MAAGGIIGGF LGGVAGVTSL LLMKASGTSM EEVRYWQYKW RLDRDENIQQ AFKKLTEDEN PELFKAHDEK TSEHVSLDTI K. It is sometimes possible for the material contained within the vial of "RPII140-upstream gene protein (140up), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
