Zinc finger protein 207 (ZNF207) Recombinant Protein | ZNF207 recombinant protein
Recombinant Pongo abelii Zinc finger protein 207 (ZNF207)
Gene Names
ZNF207; BuGZ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 207 (ZNF207); Recombinant Pongo abelii Zinc finger protein 207 (ZNF207); ZNF207 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-494, Full length protein
Sequence
MGRKKKKQLKPWCWYCNRDFDDEKILTQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDEGRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKAPFPSTAQAQVAVQGPVGTDFKPLNSTPATSTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY
Sequence Length
494
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,580 Da
NCBI Official Full Name
BUB3-interacting and GLEBS motif-containing protein ZNF207
NCBI Official Symbol
ZNF207
NCBI Official Synonym Symbols
BuGZ
NCBI Protein Information
BUB3-interacting and GLEBS motif-containing protein ZNF207
UniProt Protein Name
BUB3-interacting and GLEBS motif-containing protein ZNF207
Protein Family
UniProt Gene Name
ZNF207
UniProt Synonym Gene Names
BuGZ
Uniprot Description
Kinetochore- and microtubule-binding protein that plays a key role in spindle assembly. ZNF207/BuGZ is mainly composed of disordered low-complexity regions and undergoes phase transition or coacervation to form temperature-dependent liquid droplets. Coacervation promotes microtubule bundling and concentrates tubulin, promoting microtubule polymerization and assembly of spindle and spindle matrix by concentrating its building blocks. Also acts as a regulator of mitotic chromosome alignment by mediating the stability and kinetochore loading of BUB3. Mechanisms by which BUB3 is protected are unclear: according to a first report, ZNF207/BuGZ may act by blocking ubiquitination and proteasomal degradation of BUB3. According to another report, the stabilization is independent of the proteasome.
Similar Products
Product Notes
The ZNF207 znf207 (Catalog #AAA1357168) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-494, Full length protein. The amino acid sequence is listed below: MGRKKKKQLK PWCWYCNRDF DDEKILTQHQ KAKHFKCHIC HKKLYTGPGL AIHCMQVHKE TIDAVPNAIP GRTDIELEIY GMEGIPEKDM DEGRRLLEQK TQESQKKKQQ DDSDEYDDDD SAASTSFQPQ PVQPQQGYIP PMAQPGLPPV PGAPGMPPGI PPLMPGVPPL MPGMPPVMPG MPPGLHHQRK YTQSFCGENI MMPMGGMMPP GPGIPPLMPG MPPGMPPPVP RPGIPPMTQA QAVSAPGILN RPPAPTATVP APQPPVTKPL FPSAGQMGTP VTSSSTASSN SESLSASSKA PFPSTAQAQV AVQGPVGTDF KPLNSTPATS TEPPKPTFPA YTQSTASTTS TTNSTAAKPA ASITSKPATL TTTSATSKLI HPDEDISLEE RRAQLPKYQR NLPRPGQAPI GNPPVGPIGG MMPPQPGIPQ QQGMRPPMPP HGQYGGHHQG MPGYLPGAMP PYGQGPPMVP PYQGGPPRPP MGMRPPVMSQ GGRY. It is sometimes possible for the material contained within the vial of "Zinc finger protein 207 (ZNF207), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
