Putative enoyl-CoA hydratase/isomerase yhaR (yhaR) Recombinant Protein | yhaR recombinant protein
Recombinant Bacillus subtilis Putative enoyl-CoA hydratase/isomerase yhaR (yhaR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative enoyl-CoA hydratase/isomerase yhaR (yhaR); Recombinant Bacillus subtilis Putative enoyl-CoA hydratase/isomerase yhaR (yhaR); Recombinant Putative enoyl-CoA hydratase/isomerase yhaR (yhaR); Putative enoyl-CoA hydratase/isomerase yhaR; yhaR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-255
Sequence
MEFVQYACNGAVAEIILNRPDAHHALNEQMLSELKEAVEMAAASEALIVLLRGSGKGFSAGGDIRMMTSEHDPDQFKRLMDTIEAVTLNLYQMKKVTIAAIHGAAAGLGLSLALCADIVLAEKNAVLAMNFIGIGLVPDGGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTFAGDPAEGARPIIETLLASPLLAMIETKGIFQSLQIEELKKVLSLERSAQERMRRTKDHQEGIRAFLEKREPKFQA
Sequence Length
255
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,610 Da
NCBI Official Full Name
enoyl-CoA hydratase
NCBI Official Symbol
yhaR
NCBI Protein Information
enoyl-CoA hydratase
UniProt Protein Name
Putative enoyl-CoA hydratase/isomerase YhaR
Protein Family
UniProt Gene Name
yhaR
UniProt Entry Name
YHAR_BACSU
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the enoyl-CoA hydratase/isomerase family.
Sequence caution: The sequence CAA74425.1 differs from that shown. Reason: Erroneous termination at position 256. Translated as stop.The sequence CAA74425.1 differs from that shown. Reason: Frameshift at position 247.
Similar Products
Product Notes
The yhaR yhar (Catalog #AAA1235534) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-255. The amino acid sequence is listed below: MEFVQYACNG AVAEIILNRP DAHHALNEQM LSELKEAVEM AAASEALIVL LRGSGKGFSA GGDIRMMTSE HDPDQFKRLM DTIEAVTLNL YQMKKVTIAA IHGAAAGLGL SLALCADIVL AEKNAVLAMN FIGIGLVPDG GGHYLLKKRI GEAKAKKLIW SGKKLSASEA ADMGLLDGTF AGDPAEGARP IIETLLASPL LAMIETKGIF QSLQIEELKK VLSLERSAQE RMRRTKDHQE GIRAFLEKRE PKFQA. It is sometimes possible for the material contained within the vial of "Putative enoyl-CoA hydratase/isomerase yhaR (yhaR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
