Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vacuolar protein sorting-associated protein 13C (VPS13C) Recombinant Protein | VPS13C recombinant protein

Recombinant Human Vacuolar protein sorting-associated protein 13C (VPS13C) , partial

Gene Names
VPS13C; PARK23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vacuolar protein sorting-associated protein 13C (VPS13C); Recombinant Human Vacuolar protein sorting-associated protein 13C (VPS13C); partial; VPS13C recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1270-1357aa. Partial
Sequence
RVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQ
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
403,084 Da
NCBI Official Full Name
vacuolar protein sorting-associated protein 13C isoform 2B
NCBI Official Synonym Full Names
vacuolar protein sorting 13 homolog C
NCBI Official Symbol
VPS13C
NCBI Official Synonym Symbols
PARK23
NCBI Protein Information
vacuolar protein sorting-associated protein 13C
UniProt Protein Name
Vacuolar protein sorting-associated protein 13C
UniProt Gene Name
VPS13C

NCBI Description

This gene encodes a member of the vacuolar protein sorting-associated 13 gene family. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]

Uniprot Description

Necessary for proper mitochondrial function and maintenance of mitochondrial transmembrane potential. Involved in the regulation of PINK1/PRKN-mediated mitophagy in response to mitochondrial depolarization.

Research Articles on VPS13C

Similar Products

Product Notes

The VPS13C vps13c (Catalog #AAA1407930) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1270-1357aa. Partial. The amino acid sequence is listed below: RVHNQFSLVS DEDYLNPPVI DRMDVQLTKL TLYRTVIQPG IYHPDIQLLH PINLEFLVNR NLAASWYHKV PVVEIKGHLD SMNVSLNQ. It is sometimes possible for the material contained within the vial of "Vacuolar protein sorting-associated protein 13C (VPS13C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.